KEGG   Erwinia amylovora CFBP1430: EAMY_3450Help
Entry
EAMY_3450         CDS       T01197                                 

Gene name
ycjM
Definition
sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
eam  Erwinia amylovora CFBP1430
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:eam00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    EAMY_3450 (ycjM)
Enzymes [BR:eam01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     EAMY_3450 (ycjM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3543403..3545091
Genome map
AA seq 562 aa AA seqDB search
MTIIDRLINEIYDSAFPPARLQQLHALVAAARERICQPRKAHWDQQDVVLIAYADQFHED
NTPTLATFSRFYRQHLQSSFNLVHLLPFFPSSSDDGFAVIDYHQVDPPYGSWQDIAELHQ
HTRLMFDFVCNHMSAHSAWFAHYLAQDPGWDNFFISRPPAADLSAVTRPRTSPLLTPFVM
ANGEARSVWTTFSADQVDLNYADPDVLLSMVTVLLDYLQQGADYLRLDAVGYLWKTPGTA
CIHLAKTHLLVKLFRAIIDEVAAGTVLLTETNVPHDDNIRYFGNGRDEAHMVYQFPLPPL
VLHAIHHGSSRALRQWASSLDGGSGSTTFFNFLASHDGIGLNPLRGILPEHEIVALAQDL
AREGALISWKTNPDGTTSPYEINVTYLDALSKERDDDDSRLQRFLLAHGLLLAFPGVPAV
YVQSILGSRNDLDGVKVAGMNRAINRQKYALSDIEKALAATGSLRQRVWYALSQLIQVRI
RQAAFHPDNPMTIGDSDDSLLVMQRQTKNAQDTLCCVFNLSAKPVGYRLPEPRWYRDVAS
GERIDGKEELVLDAWQFRWLQP
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgactattattgatagattaatcaatgagatctatgattccgctttcccgccagcacgc
ctgcaacagctgcacgcgctggttgccgctgcccgcgagcgtatttgccagccgcgcaag
gcgcactgggatcagcaagacgtggtgctgatcgcctacgcggatcagtttcatgaagat
aacacccccaccctggcgaccttctcgcgcttctaccggcaacatttacagtccagcttt
aacctcgttcacctgctgcccttttttccgtcatcgtcggacgatggcttcgcggtgatc
gactatcatcaggtggatccgccttacggcagctggcaggacattgccgaactgcatcag
cacacgcgcctgatgtttgacttcgtctgcaaccatatgtcggcccacagcgcctggttc
gcccactacctggctcaggatcccggctgggataacttttttatcagccggccacccgct
gctgatttaagcgcggtcacccgaccgcgcacttcgccgttgctcacgccgttcgtgatg
gcaaacggcgaggcgcgctcggtctggaccaccttcagcgccgaccaggtcgaccttaat
tatgccgatcctgacgtgctgctcagtatggtcaccgtgctgctggattatttacaacag
ggggcagattacctgcggctggatgcggtaggttacttatggaaaaccccgggtacggcg
tgcatccatttagccaaaacccacctgctggtgaagctgttccgtgccatcatcgacgag
gtggccgcgggaacggtactgctgaccgaaaccaacgtgccgcatgacgacaacatccgc
tatttcggcaacggccgtgatgaagcgcatatggtctatcagtttccgttgccgccgctg
gtgctgcatgccatccaccacggttcatcacgcgcattacgccagtgggcatcctcgctc
gacggcggcagcggcagcaccaccttctttaatttcctcgcctctcatgacggtatcggc
ctgaatccgctgcgcggcattctgcctgaacacgaaatcgtcgcgctggcgcaagacctg
gcgcgggaaggcgcgctgatctcgtggaaaaccaatcctgatggcaccaccagcccttat
gaaatcaacgtcacctacctggacgcgctgagtaaagaacgggacgacgacgatagccgc
ctgcaacgatttttactggctcacgggctgctgctggcttttcccggcgtgccggcggtt
tacgtgcagagcattcttggctcgcgcaatgacctggacggcgtcaaagtcgccgggatg
aaccgggcgattaaccgccagaaatatgcactgagcgacattgaaaaggcgctggccgca
acgggctcgctgcgccagcgagtatggtatgcgctcagtcaactgattcaggtacgcatt
cgtcaggcggcattccatcccgataatcccatgacgattggcgacagcgatgattcgctg
ctggtgatgcaaaggcagacaaaaaatgcacaggatacgctgtgttgcgtgttcaacctg
agcgctaagccggtcggttaccgtctacccgaaccgcgctggtaccgcgatgtcgccagc
ggcgaacggattgatggtaaagaggagctggtgctggacgcatggcaatttcgctggctg
caaccctga

DBGET integrated database retrieval system