KEGG   Erwinia amylovora CFBP1430: EAMY_3454Help
Entry
EAMY_3454         CDS       T01197                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
eam  Erwinia amylovora CFBP1430
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eam00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    EAMY_3454 (malQ)
Enzymes [BR:eam01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     EAMY_3454 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3547444..3549513)
Genome map
AA seq 689 aa AA seqDB search
MSIKKVAQASAAAGIAPTWVNAAGKEQAVSQATREKLLAAMNPPQKASNAPLPPCKVLLK
KRVQQLQIGGKGDYQWQLHGEHGKTFQGSVCAGELLTLPANLPNGYHQLLLRQGKKQWAC
RVIVAPRRCYEPAVLKQGGKLWGAIVQLYTLRSQHNWGTGDFGDLKRMISEIAVRGGSFI
GLNPIHALYPGIPENASPYSPSSRRWLNVMYIDVAAVVDFQQSQAAQRWWRQKNTRQRLK
KVRQADWVDYAAVGELKIRGLRFGWQQFSQRTQQDATRIEFEQFIVDGGQSLADQAAYDA
LHAQMLQEDAERWGWPAWPEAYQHGHSDAVQRFRCEQADEVRFWQWLQWLADRQFAECWQ
CCQQHHMPIGLYRDLAVGVAQGGAETWCDRELYRLQASVGAPPDILGPQGQNWGLPPMDP
HVLTARGYQPFIDMLRANMVNCGALRIDHVMSLLRLWWIPYGETANFGAYVHYPVDDLMA
ILALESERQQCMVIGEDLGTVPAEIVSKLRDNRIYSWKVLYFEQDETGRYRSPDAWPRQS
MASATTHDLPTLGGFWSAGDLTLGETLGLYPDKQVLSELFADRAHKKQQLLDALHRAGCV
AKRCAKQAAKMAMSAALNRGLQRYIADSHSALLGLQPEDWLNMEKPVNVPGTTDQYPNWR
RKLSVTQEVMFADARINRLLKDLNKRRSG
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atgagtataaaaaaagttgcacaggctagcgctgcggctggtattgcccccacctgggtc
aatgctgccggtaaagagcaggccgtcagtcaggcgacgcgtgaaaagctgctggcggca
atgaatccgccgcaaaaagccagcaacgccccgctgcccccctgtaaggtgctgctgaaa
aaacgggttcagcagctacagattggcggcaaaggcgactatcaatggcagctgcacggc
gagcacggtaagacgtttcagggaagcgtatgcgctggagagctactgacgctgccggcg
aacttgcccaacggctatcatcagctgctgcttcgccaggggaagaagcagtgggcgtgc
cgggttattgttgcccccaggcgctgttatgaaccggcagtgctcaaacagggcggcaaa
ttgtggggcgcgattgtgcagctttataccctacgctcgcagcacaactgggggacaggc
gacttcggcgatctgaagcgcatgataagcgagatcgccgtacgcggcggatcctttatc
ggccttaatcccatccatgccttgtaccctggcatcccggaaaacgccagcccttacagc
ccttcatcgcgccgctggctcaacgtgatgtatatcgacgtagctgcggtggtcgacttc
cagcaaagccaggccgcgcagcgctggtggcgacagaagaatacccggcagcggctgaaa
aaggtgcgccaggcagattgggtggattacgccgcggtgggtgaactcaaaattcgcggg
ctgcgcttcggctggcagcagttctcgcagcgtacgcagcaggatgccacccgcattgaa
ttcgaacagtttattgtcgatggcgggcaaagcctggctgaccaggctgcctatgacgcc
cttcatgcgcagatgctgcaagaagacgcggagcgctggggctggccggcgtggccggaa
gcttatcaacacgggcacagcgacgcggtgcaacggttccgttgtgaacaggctgatgaa
gtgcgtttctggcaatggctgcaatggctggccgaccgtcagttcgccgaatgctggcag
tgctgtcagcagcaccatatgccgattggcctgtaccgggacctggcggttggcgtggcg
caaggcggggcagaaacctggtgtgaccgcgagctgtatcgcctgcaggcttcggtagga
gcgccgccggatatccttggcccgcaggggcagaactgggggttgccgccaatggatccg
catgtactgaccgcgcggggttatcaaccctttatcgatatgctgcgcgcaaatatggtc
aactgcggcgcattgcgcattgaccatgtgatgtcgctgctgcgcctgtggtggatccct
tacggtgaaaccgccaactttggggcctatgttcactacccggtggacgatctgatggcg
atcctcgcactggaaagcgagcgccaacagtgcatggtgattggtgaagatctcggcacg
gttccggctgaaatcgtcagcaagctgcgcgataaccgcatttactcgtggaaggtcctc
tattttgagcaggatgaaacggggcgttaccgctctcctgatgcctggccacgtcagtcg
atggccagcgccaccacccacgatttgcctacgctaggtggtttctggagcgcaggggac
ttaaccctgggtgaaacgctggggctgtacccggataagcaggtactcagtgaactgttt
gccgaccgggcgcacaaaaaacagcagctgcttgatgccctgcaccgtgcgggctgcgta
gcgaaacgctgcgctaaacaggcggctaagatggcgatgtcggcggctttgaaccgcggc
ctgcagcgctatatcgccgacagtcatagcgcgctgctcggcctgcagcctgaggactgg
ctgaatatggagaagccggtcaacgtaccgggtaccactgaccagtacccgaactggcga
cgcaagctaagcgtaacgcaggaggtcatgtttgccgatgccagaattaaccgcctgctt
aaagatctcaataaacgccgcagcggctga

  All links  
No link information was found.   
DBGET integrated database retrieval system