KEGG   Erwinia amylovora CFBP1430: EAMY_3469Help
Entry
EAMY_3469         CDS       T01197                                 

Gene name
glgB
Definition
1,4-alpha-glucan branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
eam  Erwinia amylovora CFBP1430
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:eam00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    EAMY_3469 (glgB)
Enzymes [BR:eam01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     EAMY_3469 (glgB)
Exosome [BR:eam04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   EAMY_3469 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3565174..3567360)
Genome map
AA seq 728 aa AA seqDB search
MSELVDRRVINAVVSGHFADPFSLLGMHQTRLGLEVRALLPDASEVWVIETASGNKCVQL
KCLDARGFFHAVIPGRKKPFRYQLAVTWHGQQNLIDDAYRFGPLLPEMDGWLLAEGTHLR
PYETLGAHGDVIDGVSGTRFAVWAPNAQRVSVVGEFNYWDGRRHPMRLRREMGIWELFIP
GARNGQLYKFEMIDIHGQLRLKADPYAFEAQMRPQSASMICGIPEKTTLSPQRQRANGFD
APISIYEVHLGSWRRHTDNHFWLSYQELAQQLVPYAKEMGFTHLELMPVNEHPFDGSWGY
QPLGMYAPTRRFGTRDDFRAFITAAHQAGLNVLLDWVPGHFPTDDFGLAKFDGSELYEHG
DPREGFHQDWNTLIYNFGRREVSNYLAGNALYWIERFGIDGLRVDAVASMIYRDYSRAEG
EWVPNHFGGRENLEAIAFLRYTNRTLGHAAPGAITIAEESTDFNGVSRPPETGGLGFWFK
WDLGWMHDTLDYLKLDPIYRRHHHNLMTFGMLYSNTENFVLPLSHDEVVHGKGSILDRMP
GDAWQKFANMRAYYGWMFGFPGKKLLFMGNEFAQGKEWNHDTSLDWHLLEGEDGWHNGVQ
RLVRDLNHTYRAHPPLYQQDFDPAGFEWLVVDDFENSVFVFVRRDSDGNELIVASNFTPV
PRHDYRFGVSQAGRWREVLNTDSSHYHGSNIGNLGVVSTHDWGSHNRSHSLSLTLPPLST
LWLVREAE
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgtcagagctagtggatcgtcgtgtgattaatgctgttgtctctggtcactttgctgac
cccttttccctgctgggtatgcaccaaacccgccttggtctggaagtacgcgccctgttg
ccggatgccagcgaagtctgggtgatcgaaaccgccagcgggaataaatgcgtgcagctg
aaatgcctggacgcacgcggtttttttcacgcggtgatccccgggcgtaaaaagccgttt
cgttaccagctggcagttacctggcacggccagcaaaatctgattgatgacgcctatcgc
tttggcccgctgctgcctgaaatggacggctggctgctggcggaagggacgcatctgcgt
ccctatgaaaccctgggcgctcacggggatgtgatcgatggggtttctggtacacgcttc
gccgtctgggcgcctaacgcccagcgtgtttccgtagtcggggagtttaactactgggac
ggacgtcgccacccgatgcgtctgcggcgtgaaatggggatctgggagctgtttattccc
ggcgcgcgcaatggtcagttatataaatttgaaatgattgatattcacggtcagctgcgg
ctaaaggctgacccctacgcgttcgaagcgcaaatgcgcccgcaaagcgcttccatgatc
tgcggtattcctgaaaaaaccacgctgtcaccgcagcgccagcgcgccaatggtttcgat
gcgccaatctctatctatgaagtgcatcttggctcctggcggcggcataccgataaccat
ttctggctcagttatcaggagctggcgcagcagctggtgccgtacgccaaagagatgggc
ttcacccacctggaactgatgccggtcaatgagcacccgtttgacggcagctggggctat
cagccgctgggcatgtacgcacccacccgccgtttcggtacgcgggatgatttccgcgcg
tttattactgcggcccatcaggctggtctgaacgtcctgcttgactgggtgcccggccat
tttccaacggatgattttggcttggcgaagtttgacggcagcgagctgtatgaacacggc
gacccgcgtgagggattccaccaggactggaatacgctgatttacaattttggccgccgt
gaagtcagcaactatctggcgggcaatgcgctgtactggattgaacgctttggcattgat
gggctgcgcgtggatgcggtggcttcgatgatctaccgtgactacagtcgggcagagggc
gaatgggttccgaatcatttcggtgggcgggaaaacctcgaagccattgcctttctgcgc
tacaccaaccgcacgctcggccatgccgcgcccggtgcgattaccatcgctgaagagtcg
acggactttaacggcgtatcgcgcccgccggaaacgggtgggctggggttctggtttaaa
tgggacctcggctggatgcacgacacgctggattatttgaagctcgacccgatctatcgc
cgccatcatcacaatctgatgacctttggcatgttgtacagcaacacagaaaactttgtg
ctgccgctatcgcacgatgaagtggtacacggcaagggttcaattctcgaccgtatgccg
ggggatgcctggcagaaatttgccaatatgcgcgcttactacggctggatgttcggtttc
cccggcaaaaaactgctgtttatgggcaacgaattcgcccagggcaaagagtggaaccac
gacaccagcctggactggcatttgctggaaggggaagacggctggcataacggcgtacag
cgcctggtgcgcgacctgaatcacacctaccgcgcgcatccaccgttatatcagcaggat
tttgacccggcggggtttgagtggctggtggtggatgactttgaaaactcggtatttgtc
tttgtgcgccgcgatagtgacggtaacgaactgattgttgccagtaactttacgccagta
ccgcgccacgactatcgctttggcgtgtcacaggcagggcgctggcgcgaggtgctgaat
accgattccagccattatcacggcagcaacattggcaacctcggtgtggtcagcacccat
gactggggcagccataaccgcagccactctctgagcctgacgttgccaccgctgtcaacg
ttatggctggtgcgggaggcagaatga

DBGET integrated database retrieval system