KEGG   Erwinia amylovora CFBP1430: EAMY_3602Help
Entry
EAMY_3602         CDS       T01197                                 

Gene name
celA3
Definition
endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
eam  Erwinia amylovora CFBP1430
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eam00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    EAMY_3602 (celA3)
Enzymes [BR:eam01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     EAMY_3602 (celA3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3694785..3695759)
Genome map
AA seq 324 aa AA seqDB search
MLLALIMGMSQAMAADGWSSFKTRFMTSDGRIQDTGNQNVSHTEGQGYAMLMAVYFNDRS
SFDKLWHWTQNNLSNPKNGLFYWKYTPGASDPVSDKNNASDGDVLIAWALLKAGEKWQVP
GWLQQSDRIQRAIVAHNVIAFGGRTVMLPGVQGFNKTSYVVLNPSYFVFPAWRDFARRSH
LKVWEQLIGDGQNLLTEMHFGDTALPLDWVAMNADGSLAPATAWPPRFSYDAIRIPLYLH
WYDATSSGLVPFQRFWAGFQRLQTPAWVDVISNNKAPYYMAGGLLAVRDLTLGDTGYLDG
SPGASEDYYSSSLHLLTWLAFKDR
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgctgttggcgctcataatgggaatgtctcaggcgatggccgcagatggctggagcagc
ttcaaaacgcgctttatgaccagcgatggccggattcaggataccggcaatcagaacgtc
agccacaccgaaggccagggctatgccatgctgatggcggtttatttcaacgaccgcagc
agctttgacaagctgtggcactggacgcagaacaacctcagtaacccgaaaaatggcctg
ttttactggaaatacacccccggagccagcgacccggttagcgacaaaaataatgcctcc
gacggggatgtactgatcgcctgggcgctactgaaggcgggagaaaagtggcaggttccc
ggctggttgcagcagtcagaccgtattcagcgggccattgtggcgcataacgtgattgcc
tttgggggccgcaccgtgatgctgcccggtgtgcagggcttcaataaaaccagctacgtg
gtgctgaacccctcctattttgtcttcccggcgtggcgtgattttgcccggcgcagtcac
ttaaaggtgtgggagcagctgattggagacggacagaatttgctcacggaaatgcatttt
ggcgataccgctctgccgctggactgggtggcaatgaacgccgacggctcgctggcaccg
gctaccgcctggccaccacgatttagttatgatgcgatccgtattccgttgtacctgcac
tggtacgacgccacgtcttcagggctggtgccgttccagcgtttctgggccggtttccag
cgcctgcaaaccccggcatgggtagatgtgataagcaacaacaaagctccctactatatg
gcaggcggcctgctggcggtgcgtgatttaaccctgggtgacaccggatatctcgatgga
tcaccgggcgccagtgaagactattactcatcaagcctgcacctgttaacctggctggcg
tttaaagaccgctaa

DBGET integrated database retrieval system