KEGG   Erwinia amylovora CFBP1430: EAMY_3665Help
Entry
EAMY_3665         CDS       T01197                                 

Gene name
kdgK
Definition
2-dehydro-3-deoxygluconokinase
Orthology
K00874  
2-dehydro-3-deoxygluconokinase [EC:2.7.1.45]
Organism
eam  Erwinia amylovora CFBP1430
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:eam00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EAMY_3665 (kdgK)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    EAMY_3665 (kdgK)
Enzymes [BR:eam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.45  2-dehydro-3-deoxygluconokinase
     EAMY_3665 (kdgK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3757434..3758387
Genome map
AA seq 317 aa AA seqDB search
MTIDANGTLDAVTIGEAMAMFVAAEAGDLATVTRFTKRIAGAELNVAIGLARLGLKVGWV
SRIGDDSFGRFTCQQLDKEGVDRRHVTPDRRYPTGFQLKSKVDDGSDPLVEYFRKGSAAS
HLSPADFDRDYFGSARHLHLSGVAAAISDYSLALSLYAAREMKAMGKTISFDPNLRPVLW
SSEQEMVRQLNNLAQYADWVLPGINEGKILTGYHQPEAIADFYLAMGAKAVVIKIGCDGA
WYKTADGDHGQVAAVKTDNVIDTVGAGDGFAVGVISALLEGKSLPAAVLRGNKIGSLAIQ
AIGDSEGLPTRTKLGDF
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgactattgatgccaatggcacgctggatgccgtcaccatcggtgaagcgatggcaatg
tttgtcgctgctgaagcaggcgatctcgccacggtgacccgttttaccaaacgcattgcg
ggggcagaactgaatgtggcgattggcctggcgcgcctgggactgaaagtgggttgggtt
agccgcattggtgacgactcctttggccgttttacctgccagcagctggacaaggaagga
gtcgatcgccgccacgtgacgccggacagacgttaccccaccggatttcagctcaagtcg
aaagtcgatgatggttccgatccgctggtggagtatttccgtaaaggctccgccgccagc
catctgtcgccggcagattttgatcgtgactatttcggcagcgcgcgtcatctgcatctt
agcggcgtggcagcggccatctccgactattcgctggccctgtcgctgtatgcggcacgc
gaaatgaaagcgatgggtaagaccatctccttcgatcccaatctgcgcccggtgctgtgg
tcaagcgagcaggagatggtcaggcagctgaataatctggcgcaatatgccgactgggta
ctgccgggcattaacgaagggaaaatccttaccggctatcaccagccggaagctatcgcc
gatttttatctggcaatgggcgccaaagcggtggtgatcaagatcggctgcgatggagcc
tggtacaaaaccgctgacggtgaccatggccaggtggcagcggtgaaaaccgataacgtc
attgataccgtcggagccggtgacggctttgcggttggcgtgatcagcgcactgctggaa
ggaaaatcgttacccgcagcggttctgcgcggcaacaaaatcgggtcgctggcgattcag
gccatcggcgacagcgaaggattaccgacgcgcaccaaactgggtgatttctaa

DBGET integrated database retrieval system