KEGG   Erwinia amylovora CFBP1430: EAMY_3665Help
Entry
EAMY_3665         CDS       T01197                                 

Gene name
kdgK
Definition
2-dehydro-3-deoxygluconokinase
Orthology
K00874  
2-dehydro-3-deoxygluconokinase [EC:2.7.1.45]
Organism
eam  Erwinia amylovora CFBP1430
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:eam01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:eam00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3757434..3758387
Genome map
AA seq 317 aa AA seqDB search
MTIDANGTLDAVTIGEAMAMFVAAEAGDLATVTRFTKRIAGAELNVAIGLARLGLKVGWV
SRIGDDSFGRFTCQQLDKEGVDRRHVTPDRRYPTGFQLKSKVDDGSDPLVEYFRKGSAAS
HLSPADFDRDYFGSARHLHLSGVAAAISDYSLALSLYAAREMKAMGKTISFDPNLRPVLW
SSEQEMVRQLNNLAQYADWVLPGINEGKILTGYHQPEAIADFYLAMGAKAVVIKIGCDGA
WYKTADGDHGQVAAVKTDNVIDTVGAGDGFAVGVISALLEGKSLPAAVLRGNKIGSLAIQ
AIGDSEGLPTRTKLGDF
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgactattgatgccaatggcacgctggatgccgtcaccatcggtgaagcgatggcaatg
tttgtcgctgctgaagcaggcgatctcgccacggtgacccgttttaccaaacgcattgcg
ggggcagaactgaatgtggcgattggcctggcgcgcctgggactgaaagtgggttgggtt
agccgcattggtgacgactcctttggccgttttacctgccagcagctggacaaggaagga
gtcgatcgccgccacgtgacgccggacagacgttaccccaccggatttcagctcaagtcg
aaagtcgatgatggttccgatccgctggtggagtatttccgtaaaggctccgccgccagc
catctgtcgccggcagattttgatcgtgactatttcggcagcgcgcgtcatctgcatctt
agcggcgtggcagcggccatctccgactattcgctggccctgtcgctgtatgcggcacgc
gaaatgaaagcgatgggtaagaccatctccttcgatcccaatctgcgcccggtgctgtgg
tcaagcgagcaggagatggtcaggcagctgaataatctggcgcaatatgccgactgggta
ctgccgggcattaacgaagggaaaatccttaccggctatcaccagccggaagctatcgcc
gatttttatctggcaatgggcgccaaagcggtggtgatcaagatcggctgcgatggagcc
tggtacaaaaccgctgacggtgaccatggccaggtggcagcggtgaaaaccgataacgtc
attgataccgtcggagccggtgacggctttgcggttggcgtgatcagcgcactgctggaa
ggaaaatcgttacccgcagcggttctgcgcggcaacaaaatcgggtcgctggcgattcag
gccatcggcgacagcgaaggattaccgacgcgcaccaaactgggtgatttctaa

DBGET integrated database retrieval system