KEGG   Exiguobacterium antarcticum: Eab7_0016Help
Entry
Eab7_0016         CDS       T02258                                 

Gene name
dck
Definition
Deoxyadenosine/deoxycytidine kinase
Orthology
K15519  
deoxyadenosine/deoxycytidine kinase [EC:2.7.1.76 2.7.1.74]
Organism
ean  Exiguobacterium antarcticum
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ean00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Eab7_0016 (dck)
   00240 Pyrimidine metabolism
    Eab7_0016 (dck)
Enzymes [BR:ean01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     Eab7_0016 (dck)
    2.7.1.76  2'-deoxyadenosine kinase
     Eab7_0016 (dck)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(24192..24869)
Genome map
AA seq 225 aa AA seqDB search
MNSKLREKYNIPADAVITIGGMVGIGKSTITNGLADSLGFRTSLEKVDTNPYLDKFYHDF
ERWSFHLQIYFLAERFKEQKKIFQYGGGFIQDRSIYEDTGIFAKMHFEKGTMSPTDYETY
SSLFDAMVMTPFFPHPDLLIYLEGSFEQVLERIRLRGREMEQQTPIEYWEEMYERYTNWI
NNFTICPVLRLSIDEYDLLNEPESIERILSKIDKQLEVARIAKIR
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgaactcgaagttacgcgaaaagtataacatcccggcagatgccgtcatcacgattggt
ggaatggtcggtatcggtaaatcgacgatcacgaacggtctagcagactcacttggtttc
cggacatctcttgaaaaagtcgatacaaacccttatctcgataaattctaccatgatttc
gagcggtggagcttccacttgcagatctacttcttggcagaacggtttaaggaacaaaag
aaaatcttccaatacggtgggggtttcattcaagaccgttcgatttacgaagatacaggc
attttcgcgaagatgcacttcgaaaaaggaacgatgtcaccaacagactatgagacctac
tcaagtctgtttgatgcgatggtcatgacgccgtttttcccgcatccggatttgttgatt
tatctcgaaggttcattcgaacaggtcttggagcgcattcgtctccgtggacgtgagatg
gagcaacagacaccaatcgagtattgggaagagatgtatgagcggtatacaaactggatc
aacaactttacgatctgtcctgtcctccgtttgtcgatcgatgagtacgatctgttaaac
gaaccggaatcaattgaacggattttatcaaaaatcgacaagcaacttgaagttgcccgg
attgcgaagatccgctaa

DBGET integrated database retrieval system