KEGG   Exiguobacterium antarcticum: Eab7_0016Help
Entry
Eab7_0016         CDS       T02258                                 

Gene name
dck
Definition
Deoxyadenosine/deoxycytidine kinase
Orthology
K15519  
deoxyadenosine/deoxycytidine kinase [EC:2.7.1.76 2.7.1.74]
Organism
ean  Exiguobacterium antarcticum
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:ean00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:ean00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(24192..24869)
Genome map
AA seq 225 aa AA seqDB search
MNSKLREKYNIPADAVITIGGMVGIGKSTITNGLADSLGFRTSLEKVDTNPYLDKFYHDF
ERWSFHLQIYFLAERFKEQKKIFQYGGGFIQDRSIYEDTGIFAKMHFEKGTMSPTDYETY
SSLFDAMVMTPFFPHPDLLIYLEGSFEQVLERIRLRGREMEQQTPIEYWEEMYERYTNWI
NNFTICPVLRLSIDEYDLLNEPESIERILSKIDKQLEVARIAKIR
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgaactcgaagttacgcgaaaagtataacatcccggcagatgccgtcatcacgattggt
ggaatggtcggtatcggtaaatcgacgatcacgaacggtctagcagactcacttggtttc
cggacatctcttgaaaaagtcgatacaaacccttatctcgataaattctaccatgatttc
gagcggtggagcttccacttgcagatctacttcttggcagaacggtttaaggaacaaaag
aaaatcttccaatacggtgggggtttcattcaagaccgttcgatttacgaagatacaggc
attttcgcgaagatgcacttcgaaaaaggaacgatgtcaccaacagactatgagacctac
tcaagtctgtttgatgcgatggtcatgacgccgtttttcccgcatccggatttgttgatt
tatctcgaaggttcattcgaacaggtcttggagcgcattcgtctccgtggacgtgagatg
gagcaacagacaccaatcgagtattgggaagagatgtatgagcggtatacaaactggatc
aacaactttacgatctgtcctgtcctccgtttgtcgatcgatgagtacgatctgttaaac
gaaccggaatcaattgaacggattttatcaaaaatcgacaagcaacttgaagttgcccgg
attgcgaagatccgctaa

DBGET integrated database retrieval system