KEGG   Exiguobacterium antarcticum: Eab7_0021Help
Entry
Eab7_0021         CDS       T02258                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
ean  Exiguobacterium antarcticum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ean00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Eab7_0021 (recR)
DNA repair and recombination proteins [BR:ean03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Eab7_0021 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
28565..29164
Genome map
AA seq 199 aa AA seqDB search
MQYPEAISRLIESFTKLPGIGPKTAVRLAFHVLDMEEDDVLMFGKALVSAKRDISYCSIC
GNITDKDPCYVCSDKHRNRTIVCVVQDSRDVIAMEKMRDYQGLYHVLHGAISPMEGIGPE
DINVSSLLTRLQADEVITEIILATNPNIEGEATAMYLSRLLKPTGIRVTRIAHGLPVGGD
LEYADEVTLSRAMEGRREL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
ttgcaatatcctgaagcaatcagccgtttgattgaaagtttcacgaagttaccagggatt
ggtccgaaaacggctgttcgtcttgccttccatgtcttagatatggaagaagacgatgtg
ttgatgttcggaaaagcactggtgagtgcgaaacgagatatttcttattgtagtatctgt
ggaaacatcacagataaagatccctgttacgtctgttccgacaaacaccgtaatcggaca
attgtttgtgtcgttcaagattcacgtgatgtcatcgcaatggaaaaaatgcgtgattat
caagggttgtatcatgtcctacatggagcaattagtccaatggaaggaatcggaccggaa
gacatcaatgtgtcgagcttattgacacgtctccaagcggacgaagtgattacagagatc
atattggcgacgaacccgaatatcgaaggggaagcgactgcgatgtatctttctcgatta
ttgaaaccaacgggcattcgcgtcactcggattgcgcatggtcttcctgttggtggcgat
ctagagtatgcggacgaagtcacgttgtctcgtgctatggagggaagacgggagttatga

DBGET integrated database retrieval system