KEGG   Exiguobacterium antarcticum: Eab7_0039Help
Entry
Eab7_0039         CDS       T02258                                 

Gene name
ispE
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
ean  Exiguobacterium antarcticum
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:ean00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
53829..54689
Genome map
AA seq 286 aa AA seqDB search
MTIIVKAPAKINLVLDATAKRPDGYHDVHMVMTTVDLADRLELTELPSGEIRMNAQHAYV
PNDERNLAYKAAAVLKERFNIRSGVEIYLEKHIPVAAGLAGGSSDAAATLRGLNELWKLD
LTLEQLAEIGAEVGSDVPFCVMGGTAIATGRGEQLEKLVSPPPCWVVLAKPTIGVSTADV
YGALDLTTAERPDVEAMIQAVKAQDFNGICDALGNVLESVTLPMHPEVEQIKAFMTSCGA
EGVLMSGSGPTVFALTEHENRAQRLYNGLRGFCNEVYVVRLLGENH
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgacgattattgtaaaagctccagcaaaaatcaatttagtattggatgcgacggcgaaa
cgtccggacggttatcatgatgtacatatggtgatgacgacagttgatttggcagaccgg
ttggaattgacggaattaccttctggtgaaattcggatgaatgcgcaacatgcgtatgta
ccgaacgatgaacggaatttagcgtataaagcggcggcggttttaaaggaacggtttaac
atccgaagtggagttgaaatctatctcgaaaaacatattccggtcgcagccggtctggcc
ggcggctcaagcgatgcggccgcgacgttacgtggcttgaatgagttgtggaaactggat
ttgacgctcgaacagttagcagagatcggggctgaagtcggatcggatgttccgttttgt
gtgatgggcgggacggcgatcgcgacgggacgcggggaacagcttgaaaaattagtatcc
cctccaccctgttgggtcgtccttgcgaaaccgacgattggtgtgtcgacggcggatgtc
tatggagcccttgatctgacgacagcggagcgaccggatgtcgaggcgatgatccaagcc
gtcaaggcgcaggatttcaatggcatctgtgacgcactcggaaatgtgttggaatcggtg
acgttaccgatgcatccggaagtcgaacagatcaaagcgttcatgacgagttgcggggcg
gaaggtgttttgatgagcggaagtggtcctactgtctttgcgctgacggaacacgaaaac
cgagcgcaacgtctgtacaatggcttacgaggtttttgtaatgaagtctacgtcgttcgt
cttttaggggaaaaccattga

DBGET integrated database retrieval system