KEGG   Exiguobacterium antarcticum: Eab7_0039Help
Entry
Eab7_0039         CDS       T02258                                 

Gene name
ispE
Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
ean  Exiguobacterium antarcticum
Pathway
ean00900  Terpenoid backbone biosynthesis
ean01100  Metabolic pathways
ean01110  Biosynthesis of secondary metabolites
ean01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ean00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Eab7_0039 (ispE)
Enzymes [BR:ean01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Eab7_0039 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: AFS69203
UniProt: K0A7A9
Position
53829..54689
Genome map
AA seq 286 aa AA seqDB search
MTIIVKAPAKINLVLDATAKRPDGYHDVHMVMTTVDLADRLELTELPSGEIRMNAQHAYV
PNDERNLAYKAAAVLKERFNIRSGVEIYLEKHIPVAAGLAGGSSDAAATLRGLNELWKLD
LTLEQLAEIGAEVGSDVPFCVMGGTAIATGRGEQLEKLVSPPPCWVVLAKPTIGVSTADV
YGALDLTTAERPDVEAMIQAVKAQDFNGICDALGNVLESVTLPMHPEVEQIKAFMTSCGA
EGVLMSGSGPTVFALTEHENRAQRLYNGLRGFCNEVYVVRLLGENH
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgacgattattgtaaaagctccagcaaaaatcaatttagtattggatgcgacggcgaaa
cgtccggacggttatcatgatgtacatatggtgatgacgacagttgatttggcagaccgg
ttggaattgacggaattaccttctggtgaaattcggatgaatgcgcaacatgcgtatgta
ccgaacgatgaacggaatttagcgtataaagcggcggcggttttaaaggaacggtttaac
atccgaagtggagttgaaatctatctcgaaaaacatattccggtcgcagccggtctggcc
ggcggctcaagcgatgcggccgcgacgttacgtggcttgaatgagttgtggaaactggat
ttgacgctcgaacagttagcagagatcggggctgaagtcggatcggatgttccgttttgt
gtgatgggcgggacggcgatcgcgacgggacgcggggaacagcttgaaaaattagtatcc
cctccaccctgttgggtcgtccttgcgaaaccgacgattggtgtgtcgacggcggatgtc
tatggagcccttgatctgacgacagcggagcgaccggatgtcgaggcgatgatccaagcc
gtcaaggcgcaggatttcaatggcatctgtgacgcactcggaaatgtgttggaatcggtg
acgttaccgatgcatccggaagtcgaacagatcaaagcgttcatgacgagttgcggggcg
gaaggtgttttgatgagcggaagtggtcctactgtctttgcgctgacggaacacgaaaac
cgagcgcaacgtctgtacaatggcttacgaggtttttgtaatgaagtctacgtcgttcgt
cttttaggggaaaaccattga

DBGET integrated database retrieval system