KEGG   Exiguobacterium antarcticum: Eab7_0237Help
Entry
Eab7_0237         CDS       T02258                                 

Gene name
speB
Definition
(GenBank) Agmatinase
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
ean  Exiguobacterium antarcticum
Pathway
ean00330  Arginine and proline metabolism
ean01100  Metabolic pathways
Module
ean_M00133  Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:ean00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Eab7_0237 (speB)
Enzymes [BR:ean01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Eab7_0237 (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase UPF0489
Motif
Other DBs
NCBI-ProteinID: AFS69399
UniProt: K0A8F9
Position
250021..250893
Genome map
AA seq 290 aa AA seqDB search
MRFDEAYSGKVFIASQPTHEDAKAVLYGMPMDWTVSFRPGSRFGPARIREVSLGLEEYSP
YLDGDIADAKLFDAGDIPLPFGNAQKSLDMIEEYVDSLLTAGKFPLGMGGEHLVTWPVVK
AFDKHYDDFVVLHFDAHTDLRDSYEGEPLSHSTPLKKIANLIGPENCYSFGIRSGMKEEF
DWAKTSGYNLFKYEIVEPLKAVLPKLAGKKVYVTIDIDVLDPSAAPGTGTQEIGGVTTKE
LLEVVHMIARADVDVIGADLVEVCPAYDQSDMTAIAAAKVLREMMIGFVK
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgcgttttgatgaagcttattcaggtaaagtatttatcgcgagccaaccgactcacgaa
gatgcaaaagctgtactatatggtatgccgatggactggacggtcagcttccgtcccggt
tcacgatttggtccggctcggatccgtgaagtctcactcggtcttgaagaatacagtccg
tatcttgacggtgatattgccgatgcgaaactgtttgacgcaggcgacatcccgcttccg
ttcggcaatgcgcaaaagtcactcgatatgatcgaagagtatgtcgattcgttgttgacg
gcagggaagttcccgcttggcatgggtggcgaacacctcgtcacgtggccggtcgtcaag
gcgtttgataaacattatgatgactttgtcgtcctgcactttgatgcgcatacggattta
cgtgattcctatgaaggcgaaccgttgtcgcactcgacgccgcttaagaaaatcgcgaac
ttgattggaccggaaaactgctattcgttcggcattcgttcaggaatgaaagaagagttc
gactgggcgaagacgtcaggatacaatctatttaagtacgaaatcgttgaaccgttaaaa
gcggtcttaccgaaactggctggtaaaaaagtctacgtgacgatcgatatcgatgtcctt
gatccgtcagctgcaccgggaaccggtacgcaggaaattggcggcgtgacgacaaaagaa
ctactcgaagtcgtccatatgattgcccgtgcggatgtcgacgtcatcggagccgatctc
gttgaggtctgtccggcgtatgaccagtctgacatgacagcgattgccgcagcaaaagtg
ttacgtgagatgatgattggattcgtcaaataa

DBGET integrated database retrieval system