KEGG   Exiguobacterium antarcticum: Eab7_0350Help
Entry
Eab7_0350         CDS       T02258                                 

Gene name
bgaA
Definition
beta-galactosidase BgaA
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
ean  Exiguobacterium antarcticum
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:ean00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Eab7_0350 (bgaA)
Enzymes [BR:ean01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Eab7_0350 (bgaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
356640..358634
Genome map
AA seq 664 aa AA seqDB search
MYLGVDYYPEQTPRALWEEDFRLMKELGVNVVRLAEFAWTMMEPEEGVYDFRFWDDIIER
LSAAGFDIVLGTPTATPPAWMCHKYPEILPADEHGVTISFGARRHYTVHSETYQRFSVAI
TTEMAKRYGKHPRVIGWQTDNEYGHEKSDRSYSEIDRAAFQVWLKNRYETLDALNETWGT
VFWSQTYTAWEQIPVPRKVYQEHNPSLLVDFDRFCADGYNHYNKLQVDALREHIHPDAFI
THNLVYSDMAVNQQQMAQDLDYVAFDNYPVWGGLPEPNRFEKMASDHDLCRSSKQGKGFW
VMEQLSGAQGWSKIGYLPRPGHIRLWTYQAVARGAEAIVYFRFRAALFGTEEFCHGIIDH
DGKPKRKFNEVKQIMTELNTFGDEINASSYQAEVGVYFDQENVWAWTHQPHSDAFDFRTE
FVRFYGGAVRRQAATDIVFPGDRLDQYKLIIVPLYFLTNPTFDQSLIDYMEQGGHVIFTY
RTGVKDPHNNVIPLTLPGKFAPYAGIEIDEYESLQAVQENRVEGIGAFAGQGSPARLWCD
LITPTTAEPLAVYRDTFYDGVAAVTRNEYKGAITYIGASIDDAMIDTIYRQAFLDAGVQT
FEAPDQVEVVRRHGETRDFIFFMNHDTKASRDVVLDAAYKEVNTNETYSGTVTLAPLETL
ILTT
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgtatttaggcgtcgattattacccggaacaaactccacgtgcgttatgggaggaagat
tttcgtttgatgaaagaacttggtgtcaatgtcgtccggttggcggaatttgcctggacg
atgatggagccggaagaaggagtctacgatttccggttttgggatgacatcatcgaacgt
ttgagtgccgccggttttgacatcgtcctcgggacaccgaccgcgacaccaccggcatgg
atgtgtcataaatatccggagattcttccggcagacgagcatggcgtgacgatcagcttt
ggagcccgtcgtcactacacggttcacagtgagacgtaccaacgcttttccgttgccatc
acgacggaaatggcgaaacggtacggaaaacatccgcgtgtcatcggttggcagacggac
aatgaatacggtcatgaaaaatcggatcgttcgtacagtgaaatcgaccgtgccgcgttc
caggtatggctgaaaaaccgatacgagacgcttgacgcgttaaacgagacgtggggaacg
gtcttctggagtcagacgtacacggcgtgggagcaaatcccagtaccgcggaaagtctac
caggaacataacccgtcgttactcgtcgacttcgaccgcttctgtgccgacggttacaac
cattacaacaaactgcaggtcgatgcgcttcgggaacacattcatccggacgcgttcatt
acacataaccttgtctacagtgatatggccgtcaatcaacaacagatggcacaggatctc
gattacgtcgcctttgacaactacccggtctggggtggtttgcctgaaccgaaccgtttc
gagaagatggcgagcgatcatgacctgtgccgatcgtcgaaacaaggaaaaggcttttgg
gtgatggagcaactcagcggagcgcaaggctggagtaaaatcggttacttgccgcgcccc
ggccacatccgtttgtggacgtatcaagcggtcgcacgtggtgccgaagccatcgtctac
ttccgtttccgggcggcgttgttcggaacggaagagttttgccacggtatcatcgatcac
gatggaaaaccaaaacgcaaattcaacgaagtcaaacagatcatgacggagctgaatacg
ttcggagacgagattaatgcaagcagctatcaagcggaagttggtgtctattttgatcaa
gagaacgtttgggcctggacgcatcaaccgcacagtgacgcatttgacttccggaccgag
ttcgtccggttctacggaggcgctgtccgtcgtcaggcagcaaccgatatcgtcttcccg
ggtgaccggctcgatcaatacaaattgattatcgttccgctgtatttcctgacgaatccg
acgtttgaccagtcgttaatcgattacatggagcaggggggacatgtcatcttcacgtac
cggaccggtgtcaaggatccgcataacaatgtcattccattgacgttaccaggcaagttc
gccccgtacgcaggaatcgaaatcgacgagtacgaatcgttgcaggcagtgcaggaaaac
cgggtcgaaggcattggagcattcgccggacaaggttcaccggcccgtctctggtgtgat
ttgatcacaccgacgacagccgaaccgctcgctgtctaccgcgatacgttttatgacgga
gtcgctgccgtcacacgcaacgaatataaaggagcaatcacgtacattggtgcatcgatt
gatgatgcgatgatcgatacgatttaccgacaagcgtttctcgatgccggtgttcagacg
tttgaggcaccggatcaagtcgaagtcgtccgccgtcacggggaaacacgtgatttcatc
ttcttcatgaaccacgatacaaaagccagccgggacgtggtgcttgatgctgcttataaa
gaagtgaatacgaacgagacatatagtggaacagtgacgctcgcaccgctcgagacactg
attctgacaacataa

DBGET integrated database retrieval system