KEGG   Exiguobacterium antarcticum: Eab7_0351Help
Entry
Eab7_0351         CDS       T02258                                 

Gene name
galA
Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
ean  Exiguobacterium antarcticum
Pathway
Galactose metabolism
Glycerolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ean00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:ean00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
358649..360781
Genome map
AA seq 710 aa AA seqDB search
MAILELPNQRFVLEGQHVAHVVTIGQHGKVLHTYFGARLPYRSDYEALPNPVLTHSSFES
PDGVAVYDFIPFGEMVYTEPTLKSEREDGQRISQFVFERAEQSDSGLILWLFDSLQELRV
GIKYDLYETYDMIGRSLVIENTGTQPVQLTAAQSFAMGILQRPSLNLHHFAGTWTGEFQK
QVTPLTPGRKTIDSRRGVTSHQANPWFALEHGATEATGEVIYGHFAYSGNWSMHFEQDAF
GFVQVSGGMNAFDFGWKLEAGQQLVTPDFYIGYAADGFAGMSARAHDFQRQIIMPESDRN
KVRPVLYNSWEATYFDVTEHGQRTLVDQAAAIGCELFVVDDGWFGERNSDQAGLGDWVVN
PEKFPNGLTPLIDYVKQQNMQFGLWVEPEMVNPDSNLYRTHPDWIYHSPGAHRTTSRNQF
VLNLGLPQVEQFVFEMMDELLGTHAIDYIKWDMNRAFSEPGLPGATPAQQQELWKRHVDA
LYRIFDELRTRHPEVDFEACAGGGGRIDLGILQRTEQVWTSDNTDPLDRLAIQHDFSFAY
NAKMMSCWVTDGPNWLNGRNLPLATRFVSSMQGTLGIGGNLSEWTAEELTEATEWIATYK
TIRETVQFGRQYRLTADRRTASLMQYTSNDQTVVLAVAPMRQHGSNQYHFRLHGLEKTGL
YQVDERQLSGAYLMQQGLTITYTTDYEACCLHIQPVHGNVITSESKEPIA
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
atggccattcttgaactgccgaatcagcggttcgtcctcgaaggacaacacgtcgcgcat
gtcgtgacgatcggacagcacggcaaagtgttgcatacgtattttggagcccgcctgccg
tatcgatctgattatgaagccttaccgaatccggtcctgacacacagctcgtttgaatca
ccggatggggttgcggtctatgatttcattccattcggtgagatggtctacacagaaccg
actttgaaatcagaacgggaggacggtcaacgaatcagccagttcgtctttgaacgcgcc
gagcaatccgacagcggattgatcttatggttgtttgattcgttacaagaacttcgggtc
ggcatcaaatacgacctgtacgaaacctacgatatgatcggacggtcactcgtgattgaa
aacaccggaacacaaccggtgcaattgacggcagcccaatcgtttgcgatgggaattcta
caacggccgagcttgaacctgcatcattttgccggaacatggaccggtgaatttcaaaag
caggtgacgccgctaacgccggggcgtaagacgattgacagccggcggggtgtgacgagt
catcaggcgaatccgtggttcgccttggagcacggtgcgacggaagcgaccggcgaagtc
atttatggtcatttcgcgtattccggcaactggtcgatgcatttcgagcaggatgcgttt
ggattcgttcaagtatcaggcgggatgaatgcgtttgatttcggttggaaacttgaagcc
ggtcaacagctcgtcacaccggacttttacatcggctacgcggcagacggctttgccggg
atgagtgcccgcgcgcacgatttccagcgtcagattatcatgccggagtccgatcgaaac
aaggtccggcctgtcctctacaattcctgggaagcaacctactttgacgtaacggaacac
ggacaacggacactcgtcgatcaagcagccgcgatcggttgcgaactgtttgtcgtcgat
gacggctggtttggtgaacgaaactccgatcaggccggtctcggtgactgggtcgtcaat
ccagagaaattcccgaacggtttaacaccgttgattgattatgtgaaacaacaaaacatg
cagtttggtctatgggtcgaaccggaaatggtcaatcctgattcaaatctgtaccggacg
catcctgactggatctaccatagtcccggtgcccaccggacgacatcacgcaatcagttt
gttctgaaccttggtttaccgcaggtcgaacaattcgtgttcgagatgatggacgagttg
cttgggacacacgcgattgattacatcaaatgggacatgaaccgtgctttttcggaaccg
ggtctcccgggtgcgacaccagcacaacaacaagaattatggaagcgtcatgtcgatgcg
ctgtaccggatttttgatgagttgcggacacgtcatccggaagtagactttgaagcttgt
gccggaggcggcggacggattgatcttggaatcctccaacggacggaacaggtctggacg
agtgataacacggatccactggaccggttggcgattcaacatgatttctcatttgcctat
aatgcgaagatgatgagctgttgggtgacggacggtccgaactggctgaacggtcggaac
ttaccgcttgcgacacgtttcgtctcctcgatgcaagggacactcggtatcggtggcaac
ttaagcgaatggacagcagaagaattaacagaagcaaccgagtggattgcgacgtacaag
acgattcgggaaaccgtccaattcggacgccagtaccgcttgacggcagaccgccggacg
gcatcgctcatgcaatacacatcaaacgatcaaacggttgtcctcgcggtagcgccgatg
cgtcagcacggttcaaaccagtaccatttccgtctgcatggacttgagaaaacgggtttg
tatcaggtcgacgaacgtcagctcagcggtgcttacttgatgcagcaaggattgacgatc
acttatacgacggattatgaagcctgttgtctacacattcagccggttcatggcaacgtc
atcacatcagagtcaaaggagccgatcgcatga

DBGET integrated database retrieval system