KEGG   Exiguobacterium antarcticum: Eab7_0370Help
Entry
Eab7_0370         CDS       T02258                                 

Gene name
paaF
Definition
(RefSeq) enoyl CoA hydratase
  KO
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ean  Exiguobacterium antarcticum
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ean00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Eab7_0370 (paaF)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Eab7_0370 (paaF)
   00650 Butanoate metabolism
    Eab7_0370 (paaF)
  Lipid metabolism
   00071 Fatty acid degradation
    Eab7_0370 (paaF)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Eab7_0370 (paaF)
   00310 Lysine degradation
    Eab7_0370 (paaF)
   00360 Phenylalanine metabolism
    Eab7_0370 (paaF)
   00380 Tryptophan metabolism
    Eab7_0370 (paaF)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Eab7_0370 (paaF)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Eab7_0370 (paaF)
   00281 Geraniol degradation
    Eab7_0370 (paaF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Eab7_0370 (paaF)
   00627 Aminobenzoate degradation
    Eab7_0370 (paaF)
   00930 Caprolactam degradation
    Eab7_0370 (paaF)
Enzymes [BR:ean01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Eab7_0370 (paaF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
377162..377938
Genome map
AA seq 258 aa AA seqDB search
MLTPQYVKTSIEGRIGRIRLNRPERYNALNRTMIREIVEAMEQFDQDEAVAVIVLDGEGK
SFSAGADIEEMLDATPISMELLDPFADWDRISRLHKPLIAAVHGFVLGGGFELALACDLI
YATPETQFGFPEVGLGVMPGAGGTQRLTKRIGRTRALEWLWTGDRMSASEAHHLGIINRI
VEADQLEANVLAVAGRIAAQPMMSVRLIKDAVDKAGDLSLQDGMDHERRNFYLLFGTSDQ
TEGMQAFLDKRQPTFKGN
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgctgacgccacagtacgttaagacgagtatcgaggggcgaatcggccggattcgactg
aaccgtccggaacgttacaatgccctgaaccggacgatgatccgggaaatcgtcgaagcg
atggagcaattcgatcaggatgaggcggtcgccgtcatcgtcctggacggtgaaggaaag
tccttttccgccggagccgacatcgaggagatgctcgacgcgacacctatttccatggaa
ctgctggatccgtttgctgattgggaccggatcagccggctgcataaaccgctgattgcg
gctgtccacggatttgtgctcggcggcggttttgaactggcactggcctgtgacttgatt
tatgcgacacccgagacgcagttcggtttcccggaggtcggactcggcgtcatgccggga
gccggcggaacccaacgactgacgaaacggatcggacggacccgggcccttgaatggtta
tggacgggcgaccggatgtcggcgtcggaagcacatcatctcggaatcatcaaccggatc
gtggaagcggaccaactcgaagcaaacgttttggcggttgccggacggattgcggcacaa
cctatgatgtccgtgcgactgatcaaagatgccgtcgataaggcaggcgatctgtcactg
caggacggcatggaccatgaacgaagaaatttctacttactattcggcacgagtgatcag
acggaagggatgcaagccttcctcgacaaacgtcaaccgacattcaaaggaaactaa

DBGET integrated database retrieval system