KEGG   Exiguobacterium antarcticum: Eab7_0402Help
Entry
Eab7_0402         CDS       T02258                                 

Gene name
mtnD
Definition
(GenBank) Acireductone dioxygenase
  KO
K08967  1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
ean  Exiguobacterium antarcticum
Pathway
ean00270  Cysteine and methionine metabolism
ean01100  Metabolic pathways
Module
ean_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:ean00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Eab7_0402 (mtnD)
Enzymes [BR:ean01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     Eab7_0402 (mtnD)
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     Eab7_0402 (mtnD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ARD Cupin_2 AraC_binding Cupin_1
Motif
Other DBs
NCBI-ProteinID: AFS69562
UniProt: K0A9X9
Position
complement(405807..406346)
Genome map
AA seq 179 aa AA seqDB search
MATVLFQKTNERYTDQNEVSAFLASRGVLYEQWDVSKLPAELVDTYTLRDADKQTILDTF
QAEITDVSERRGYQTADIISLSDATPNLDELLVNFQKEHHHTDDEVRFIVSGHGVFAIQD
DEVGYYNIELNPGDLISVPVNTRHYFTLQDDRKVVAVRIFVTTDGWVPIYEKDPIETTN
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atggcaacagtacttttccaaaaaacaaacgaacggtatacggatcaaaacgaggtgtct
gcgtttctggcttcacgcggcgtcttgtatgaacaatgggatgtctcaaagcttccggct
gaactggtcgacacctacacgttgagggacgcggacaaacaaacgattctcgatacgttc
caagctgaaatcacggatgtctcggaacgtcgcggttatcagacggctgatatcatctcc
ctgtctgacgcaacaccgaacttggatgagttgctcgtcaacttccagaaggaacaccat
cacacggatgacgaagtccggttcatcgtcagcggtcacggtgtttttgccatccaggat
gacgaagtcggctattacaacattgagttgaatccgggtgatttgatttccgtcccagtc
aacacccgtcattacttcacgcttcaagacgatcgcaaagtcgttgccgtccggattttc
gtgacgacagatggttgggttccgatttacgaaaaagatccaattgaaacaactaactaa

DBGET integrated database retrieval system