KEGG   Exiguobacterium antarcticum: Eab7_0843Help
Entry
Eab7_0843         CDS       T02258                                 

Gene name
glcK
Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
ean  Exiguobacterium antarcticum
Pathway
ean00010  Glycolysis / Gluconeogenesis
ean00052  Galactose metabolism
ean00500  Starch and sucrose metabolism
ean00520  Amino sugar and nucleotide sugar metabolism
ean00521  Streptomycin biosynthesis
ean01100  Metabolic pathways
ean01110  Biosynthesis of secondary metabolites
ean01120  Microbial metabolism in diverse environments
ean01130  Biosynthesis of antibiotics
ean01200  Carbon metabolism
Module
ean_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ean_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ean00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Eab7_0843 (glcK)
   00052 Galactose metabolism
    Eab7_0843 (glcK)
   00500 Starch and sucrose metabolism
    Eab7_0843 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    Eab7_0843 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Eab7_0843 (glcK)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Eab7_0843 (glcK)
Enzymes [BR:ean01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Eab7_0843 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FtsA FGGY_N
Motif
Other DBs
NCBI-ProteinID: AFS69987
UniProt: K0AB56
Position
883460..884416
Genome map
AA seq 318 aa AA seqDB search
MTMKWLLGVDIGGTTVKMAILDLQGIIVEKWEIETVILNDGEQIPKDIARSFFEKCQQSK
KRVEDFVGAGIGAPGFIDFNTGVVEKAVNIGWNNFELVGEFERLTGLPAVIENDANAAAI
GEMWKGAGSGATELLAVTLGTGVGGGLITNGQIVHGTVGMAGEIGHITMLPEGGVMCGCG
RKGCLETIASATGVARLGLEKRKGQVTLLNEIQAVTAKDVFDAYSKGDAIATEVVEEVAF
HLGLAISNLANSLNPEIIVIGGGVSKAGDALMTPLKETFKRFALPRVFASTTFKIAELGN
DAGVIGCAWLAKQMFLKK
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgacgatgaagtggttactcggtgtagatattggtggtacgacagtcaaaatggcgatt
ttggatctgcaaggcatcattgtagagaagtgggaaatcgagacggtcatcttgaatgat
ggagaacaaattccgaaagacatcgcacgttcgttttttgagaagtgtcaacaaagtaag
aaacgagtcgaagactttgtcggagcgggaatcggggcaccgggattcatcgatttcaat
acgggtgtcgtcgaaaaagcggtcaatatcggctggaacaacttcgaactggttggcgaa
ttcgaacgattgacgggcttgccggccgtcatcgagaatgatgccaacgcggcagcaatc
ggcgagatgtggaaaggtgcgggcagtggtgcgacggaactacttgcagtgacacttggt
acgggcgtcgggggtggattgatcaccaatggtcaaatcgttcatgggacggtcggtatg
gcaggggaaatcggacatatcacgatgttgcctgaaggtggcgtcatgtgcggatgtggg
cgtaaaggctgtctcgagacgatcgcttctgccaccggtgtagcacggttaggtcttgag
aaacgaaaagggcaagtcacgcttttaaatgaaattcaagcggtgacggcaaaggatgtt
tttgatgcctattcaaaaggagatgccattgcgacggaagtcgtcgaagaggtggccttc
caccttggactcgcgatttcgaatttggcaaacagtcttaatcctgaaatcatcgtcatt
ggcggtggggtctcaaaagccggtgatgctttgatgacgccgttaaaagaaacatttaaa
cgatttgccttgccgcgtgtctttgcatcaacaacatttaaaatcgctgaactgggcaat
gatgcgggtgtcattggttgtgcatggctcgcaaaacagatgttcctaaaaaaataa

DBGET integrated database retrieval system