KEGG   Exiguobacterium antarcticum: Eab7_0897Help
Entry
Eab7_0897         CDS       T02258                                 

Gene name
trpB
Definition
(GenBank) Tryptophan synthase beta chain
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ean  Exiguobacterium antarcticum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ean00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Eab7_0897 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Eab7_0897 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Eab7_0897 (trpB)
Enzymes [BR:ean01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Eab7_0897 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
930643..931842
Genome map
AA seq 399 aa AA seqDB search
MTRYSQPDALGQYGIYGGRYIPETLMQAVLELEQAYAEVKEDPTFYERMNDLLENYVGRK
TPLYYAEHLTRAIGGAKIYLKREDLNHTGAHKINNTIGQALLAERMGKRKIVAETGAGQH
GVATATVCALLDLECVIFMGEEDIRRQELNVFRMELLGAKVVSVTQGSRTLKDAVNEALR
YWVKHVDDTHYLMGSVLGPHPFPEIVRDFQAIIGQETRAQILEKEGKLPEAIVACVGGGS
NAIGMFHPFIEDEDVALYGIEAAGSGLDTDKHAATMSKGEVGVLHGSMMYLLQDDHGQVT
EAHSISAGLDYPGVGPEHSLLKDIGRVQYEAVTDQQALDALQLLCQKEGIIPALETAHAI
AHATELAKEMQPEEVVVICLSGRGDKDVMTVRNALKEEA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgacacgttattcacaaccggatgcactgggacaatacggaatctacggaggacgttat
attccggaaaccttgatgcaagccgttcttgaactcgaacaagcctatgcggaagtgaaa
gaagacccgactttttatgaacggatgaatgacttgctcgaaaactatgttggtcgaaaa
acaccactttattatgccgagcatttaacacgagccatcggtggggcaaaaatttattta
aaacgcgaagatttgaatcataccggtgctcataaaatcaataatacgattggtcaagca
ctgctcgctgaacgaatggggaaacgaaaaatcgtagcggagacgggtgccggacaacat
ggtgtcgcgacggcgaccgtctgtgccctgcttgatttagaatgtgtcattttcatggga
gaagaagatattcgccgtcaggaactgaacgttttccggatggagttactgggtgcgaaa
gtcgtttccgtgacacaagggagccggacgttaaaagatgccgtcaatgaagcgttacgt
tactgggtcaaacatgtcgatgatacgcattacttgatgggctccgtcctcggaccacac
ccgttcccggaaatcgtccgtgatttccaagccatcatcggtcaagagacgcgggcacaa
atccttgaaaaagaggggaaattaccggaagcgatcgtcgcttgtgtcggcggaggaagt
aatgcaatcgggatgttccatccgttcatcgaggatgaagacgtcgcgttatacggcatc
gaagcagcgggaagtggactggatacggataaacacgcagcgacgatgtcaaaaggggaa
gtcggggtcttacatggctcgatgatgtatctgttgcaagatgaccatggtcaagtgacg
gaagcccattcgatttcagccggactggattatcctggtgtcggtcccgaacatagtctg
ttaaaagatattggccgtgtccagtatgaggccgtcacggatcaacaggcactggatgcc
ctgcaattgttgtgtcaaaaagaaggcatcattccagcgcttgaaacggcgcatgccatc
gctcatgcaacagaacttgccaaagagatgcaaccggaagaagtcgtcgtcatctgtctg
tcaggacgcggcgataaagatgtcatgacagtcagaaatgctttgaaggaggaagcctga

DBGET integrated database retrieval system