KEGG   Exiguobacterium antarcticum: Eab7_0898Help
Entry
Eab7_0898         CDS       T02258                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ean  Exiguobacterium antarcticum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ean00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Eab7_0898 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Eab7_0898 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Eab7_0898 (trpA)
Enzymes [BR:ean01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Eab7_0898 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
931842..932621
Genome map
AA seq 259 aa AA seqDB search
MRLEQAIRTVNQRGEKAFIPYVMGGDGGIERLPAILAFLEKSGATAIEVGVPFSDPVADG
PVIQEAGLRALAKQVSLKDVLEAIRVARQSTTVPIVVMTYLNPIFRYGIDSFLATCREVG
VDGLIIPDLPLEQSDQFFAGRNKQEIALVQLVSLTSPIERIEKLATHSEGFLYAVTVNGT
TGGQTHFGDALEEHLAKVAQLSPVPVLAGFGISTPEHVRQLSTSVAGVIVGSKIVELLHQ
GDEVAIEQLMAARLPDVTV
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttagaacaagcaatccgcaccgttaatcaacgtggtgaaaaagcatttattcct
tatgtgatgggaggagatggaggaatcgagcggttgcccgccatcttggcatttcttgaa
aaatcaggagcgacggcgattgaggtgggtgtcccgttttctgatcccgtcgcggatggt
cctgtcattcaagaagccggattacgtgctttggcaaaacaggtcagtctaaaagatgtt
ttagaagcgattcgagtggcgagacagtcgacgaccgttccgattgtcgtcatgacgtat
ttaaatccgattttccggtatgggatcgacagcttccttgccacgtgtcgtgaagttgga
gtcgatggtttaatcattccggatttgccacttgagcaaagcgatcagttttttgccgga
cgcaacaaacaagagatcgcacttgttcaactcgtgtccttgacgagtccgatcgaacgg
attgagaaactggcaacccatagtgaaggattcctgtacgccgtcacggtcaacgggaca
acaggggggcaaacgcacttcggtgatgcattagaagagcatttggcgaaagtcgctcaa
ttgagcccggttcctgtcttagctggttttgggatcagtacaccggaacatgtccgtcaa
ctcagcacaagtgttgccggcgtcatcgtcgggagcaaaatcgtcgagttattgcaccaa
ggtgatgaagtggccatcgaacagttgatggctgcccggttaccggatgtgacggtgtaa

DBGET integrated database retrieval system