KEGG   Exiguobacterium antarcticum: Eab7_1063Help
Entry
Eab7_1063         CDS       T02258                                 

Gene name
glpK2
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ean  Exiguobacterium antarcticum
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ean00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Eab7_1063 (glpK2)
Enzymes [BR:ean01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Eab7_1063 (glpK2)
Exosome [BR:ean04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Eab7_1063 (glpK2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1095985..1097502)
Genome map
AA seq 505 aa AA seqDB search
MENKYILALDQGTTSSRAIIFDHDGHIVNSAQREFKQYFPQPGWVEHDANEIWGSILAVM
ADALGTADIKPSEIASIGITNQRETTVVWNKETGKPVYHALVWQSRQTSGICDELNARGL
NQKFRDKTGLLIDAYFSGTKVKWILDNVEGAREQAENGELLFGTIDTWLVWKLSGGKTHI
TDYTNASRTLMYNIYEQKWDDELLEILTVPKSMLPEVRQSSEVYDNTVPYHFFGFEVPIA
GIAGDQQAALLCQTCFEPGEGKNTYGTGCFMLMNTGEKAVSSDHGLLTTIAWGVDGKVEY
ALEGSIFVAGSAVQWLRDGLRMLKNAKDSEGYALKVDSTEGVYVVPAFVGLGAPYWDSDV
RGAIFGLTRGTEKEHFVRATLESLAYQTRDVLTAMEKDSGIELKTLRVDGGAVSNDFLMQ
FQADILGVPVDRPEINETTALGAAYLAGLAVGYWKDKAEIKKQWKLNRQFKPEMKEDDRE
QRYAGWQKAVEATMAFKPSKKEVNA
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacaagtatatcttagcactcgaccaaggtacaacaagctcacgcgccatcatc
tttgatcatgatggtcatatcgtcaactccgcacaacgtgaattcaaacaatatttccca
caaccaggttgggtcgaacatgatgccaacgaaatttggggatccattcttgctgtcatg
gcggatgctctcggaacagcggatatcaaacctagtgaaatcgcaagtatcggaatcacg
aaccaacgtgaaacgacggtcgtctggaacaaagagacgggtaaaccagtctatcacgca
ctcgtctggcaatctcgtcaaacatccggtatctgcgatgagttgaatgcccgaggactt
aatcaaaaattccgtgataaaacaggtctgctgattgatgcctacttctccggtacgaaa
gtcaaatggattttagataatgtcgaaggagcgcgcgagcaggctgaaaacggtgaactg
ctgtttggaacgatcgatacgtggctcgtctggaaactgtccggcggaaaaacgcatatc
acggactatacgaacgcttcacgaacattgatgtataacatttacgaacaaaaatgggat
gatgaattactcgaaatcctcacggttccgaaatcaatgttgccagaagtccgtcaatcg
agtgaagtgtacgataacaccgttccataccacttcttcggttttgaagttcccatcgcc
ggtatcgccggtgaccagcaagctgccctcttgtgtcaaacgtgcttcgaaccaggtgaa
ggaaagaacacatacggaacaggttgcttcatgttgatgaacaccggtgaaaaagctgtt
tcttcggaccacggtctgttgacgacaatcgcttggggcgtcgacggtaaagtcgaatat
gcacttgaaggatccatcttcgttgccgggtcagcggttcagtggttacgtgacgggtta
cggatgctgaaaaacgccaaggattcggaaggctatgcattgaaagtggattcgacagaa
ggcgtctatgtcgtccctgcgttcgtcggactcggcgctccttactgggatagtgatgtc
cgcggagcgatcttcggcttaacgcgtggaacggaaaaagaacatttcgtccgggcgaca
ctcgaatcactcgcttaccagacacgtgacgtcttaacggcaatggaaaaagattcgggc
atcgagctgaaaacgttacgcgtcgacggtggtgccgtttcgaatgacttcttgatgcag
ttccaagcggacattttaggtgtcccggtcgatcgtccagaaatcaacgaaacgactgcc
ctcggtgccgcttaccttgccggcttagcagtcggttactggaaagacaaagcagaaatc
aaaaaacaatggaaacttaaccgtcagttcaaaccagagatgaaagaagacgatcgtgaa
cagcgttatgccggttggcaaaaagcggtggaagcgacgatggcgtttaaaccaagtaaa
aaagaagtcaacgcttaa

DBGET integrated database retrieval system