KEGG   Exiguobacterium antarcticum: Eab7_1153Help
Entry
Eab7_1153         CDS       T02258                                 

Definition
beta-N-acetylhexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ean  Exiguobacterium antarcticum
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ean00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:ean00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1179242..1180480
Genome map
AA seq 412 aa AA seqDB search
MKRMVPVLLASVLLAGCADEPAKPAAPEPKPAKKTKPPQPDRPSAAERAEKQLKETISKM
STAEKVDQLLYIGVTGTALTQADRQLLQDHALGGVLLLGGNITSTDQLKTFTAAIGEAQT
ADEKAFLGFDEEGGRVSRVPDARLKLSPSLSFGHKNDPGLMKEVGRTLGSISRFYGFNMD
FAPVLDVNSNPANPIIGDRALSADPQQVARLGVPLMQGMKEEDIVPVVKHFPGHGDTTVD
SHVGLPRVDATKAELEQTELVPFKRAIQDGAEMVMVAHILFPALDKNRPSSLSKEVMTGV
LRSELKFDGVIITDDLVMGAITERYGLAQAAGLALENGADMAMFSSPGAYASVHKEIMER
IKQGKLSVPDLDQKVGRVLRLKETYDLSQTKRVDEYERLIERVKAVESDMRR
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacggatggttcctgttctgttagcaagcgttctgctcgccggttgcgccgacgag
cccgcaaaaccggctgcaccggaaccgaagccggcgaagaaaacaaagccaccgcaaccg
gaccgaccttctgcagctgaacgggcggaaaaacaactgaaagagaccatctcgaagatg
tcgacagcggaaaaagttgatcagttgctatacatcggcgtgacgggaacagctctgacg
caagcggaccgtcaattactgcaggaccatgcgcttggaggcgtcttgttactcggtggc
aatatcacctcgaccgatcagctgaaaacctttacggcagcgattggcgaagcgcaaacg
gcggacgaaaaagcgttccttggttttgatgaagaaggcgggcgtgtcagccgggtcccg
gatgcccgactcaaattatcaccaagtctgtcgtttggtcataaaaatgatcctggtttg
atgaaggaagtcggacggacactcggttcaatttcccgtttttacggctttaatatggac
ttcgctccagttcttgacgtcaacagtaatccggcgaatccaatcatcggcgaccgggcg
ctcagtgcggacccgcaacaagtggcacggcttggtgtgccattgatgcagggcatgaag
gaagaggatatcgtgccggtcgtcaaacattttccgggacacggcgatacgaccgtcgac
tcgcatgtcggtctgccgcgggtcgatgcgacgaaagcggaacttgagcagacggagctg
gtcccgtttaaacgggcgattcaagacggggctgaaatggtcatggtcgcgcatatcctg
ttcccggctctcgacaaaaatcgtccgtcctcattatcgaaagaagtcatgaccggtgtg
ttacggagtgaactgaaatttgatggtgtcatcatcacggacgatctcgtcatgggagcc
atcacagaacggtacggattagctcaagcggcaggtcttgcacttgaaaacggtgcggac
atggcgatgttttcctcacccggcgcgtacgcgtccgttcacaaggaaatcatggaacgg
attaaacaaggaaaactgtcggtaccggatctcgatcagaaagtcgggcgggtcttacgc
ttaaaagaaacatatgacttgtcgcaaacgaagcgcgtcgacgaatatgaacggttgatc
gaacgggtcaaagcggtcgaatcggacatgcgacgctaa

DBGET integrated database retrieval system