KEGG   Exiguobacterium antarcticum: Eab7_1181Help
Entry
Eab7_1181         CDS       T02258                                 

Definition
(GenBank) bifunctional acetaldehyde-CoA/alcohol dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
ean  Exiguobacterium antarcticum
Pathway
ean00010  Glycolysis / Gluconeogenesis
ean00071  Fatty acid degradation
ean00350  Tyrosine metabolism
ean00620  Pyruvate metabolism
ean00625  Chloroalkane and chloroalkene degradation
ean00626  Naphthalene degradation
ean00650  Butanoate metabolism
ean01100  Metabolic pathways
ean01110  Biosynthesis of secondary metabolites
ean01120  Microbial metabolism in diverse environments
ean01130  Biosynthesis of antibiotics
ean01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ean00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Eab7_1181
   00620 Pyruvate metabolism
    Eab7_1181
   00650 Butanoate metabolism
    Eab7_1181
  Lipid metabolism
   00071 Fatty acid degradation
    Eab7_1181
  Amino acid metabolism
   00350 Tyrosine metabolism
    Eab7_1181
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Eab7_1181
   00626 Naphthalene degradation
    Eab7_1181
Enzymes [BR:ean01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Eab7_1181
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Eab7_1181
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: AFS70317
UniProt: K0ABW7
Position
1202778..1205372
Genome map
AA seq 864 aa AA seqDB search
MAVKEKIKQDVSPVEQAINQIVAKGQTALQELLTFDQTKIDVIVRDMALAGLERHVELAR
LAVEETGRGVFEDKMIKNMFATEYIYNSLRDEKTVGILEEDVQNGITYIAEPVGVVCGVT
PVTNPTSTTMFKALIAIKTRNPIVFAFHPSAQQCSLEAAKTLRDAAVKAGAPQDCIQWVE
QPSLEATKVLMNHTDIAMVLATGGAGMVKSAYSTGKPALGVGPGNVPCYIEKSAKIKRAV
SDLVLSKTFDNGMICASEQAVIVDQEIYAEVRAEMEALGCYFCTADEKKRLEALVIKTDT
CAVNADIVGKPATWIAAKAGIEVPSNTVMLVAELEKVGTEEPLSHEKLSPVLGAYSVQST
EDAFHVAERMLEIGGLGHTAVIHTTNDDLMTAFGLRMKACRILVNSPSAHGGIGDLYNEL
TPSLTLGCGSYGKNSVSENVTAKHLLNIKKVARRRVNMQWFKVPEKIFFEKNSVQYLKSI
QNVSRALIVTDQSMVEFGYADKVIRNLPAGVSYRIFDQVEPDPSVTTVQVGAQAMRDFQP
DLIIALGGGSAMDAAKGMWLFYEQPNEKFSNLRQKFLDIRKRAYKFPELGNKAKFVAIPT
TSGTGSEVTPFTVITDKEKNVKYPIADYALTPDVAIVDPEFVMTVPASITADTGMDVLTH
ATEAFVSVLANDYTDGLALKAIKMIFDYLPRAYDDGSDAEAREKVHNASTMAGMAFANAF
LGINHSIAHKIGGEFHTPHGRTNAILMPHVIRYNATRPTKLAAFPKYESFIADERYAEIA
RYLGLPAATTEQGVESFIQAVSELGQRLNIKMSFKAQGIKKADFEAKLDKMAVDAFEDQC
TTANPKMPLVTELRQIMEFAYEGI
NT seq 2595 nt NT seq  +upstreamnt  +downstreamnt
atggctgtcaaagaaaaaatcaaacaagatgtctcacctgttgaacaagcaatcaatcaa
atcgtcgcgaaaggtcaaacggcgttacaagaactattaacatttgatcaaacgaaaatc
gatgtgatcgtccgggacatggcgcttgccggtctcgaacggcacgtcgaactcgcacga
cttgcggttgaagaaacaggacgtggtgtctttgaagataaaatgatcaaaaatatgttt
gcgacggaatatatctataacagtcttcgtgatgaaaaaacggtcggaattttagaagag
gatgtccaaaacggcatcacgtacatcgcagaaccggtcggtgtcgtctgtggcgtcaca
ccggtgacgaatccgacatcaacgacgatgttcaaagcgttgattgcgatcaaaacacgt
aacccgatcgtcttcgcgttccatccgtcagcacaacaatgttcgctcgaagcagcaaaa
acgttacgtgacgctgccgttaaagctggtgccccgcaagattgtatccagtgggtcgaa
caaccgtctcttgaagcaacaaaagtcttgatgaaccacaccgacatcgcgatggttctt
gcgacgggtggagccggcatggtcaaatcagcgtattcaaccggcaaaccggcacttggt
gttggaccagggaacgtaccgtgttacatcgaaaaatcagcaaaaattaagcgggccgtc
agtgatttggtcctctcgaaaacatttgataacggaatgatctgtgcctccgagcaagcg
gtcatcgtcgatcaagagatttatgcagaagtgcgggcagagatggaagcgctcggttgc
tacttctgtacagcagacgagaaaaaacgtcttgaagcacttgtcatcaaaaccgacaca
tgtgccgtcaatgcggacatcgtcgggaaaccggcaacatggatcgcagcgaaagcgggc
atcgaagtcccgagcaatacggtcatgctcgtcgccgaactcgaaaaagtcggcaccgaa
gaaccgctctcacatgaaaagctaagtcccgtccttggtgcctatagcgtccaatcaaca
gaagacgccttccacgtcgccgaacggatgcttgaaatcggtggtctcggtcacacggcg
gtcatccacacgacgaacgatgacttgatgacagcgttcggactccggatgaaagcctgc
cgaatccttgtcaacagcccgtcagcacacggtgggattggtgacttgtataacgaattg
actccatcgctgacacttggttgcggatcatacgggaaaaactcggtctctgaaaacgta
acggcgaaacatctactcaatatcaagaaggtggcgagacgacgcgtgaacatgcagtgg
ttcaaagtaccggaaaagattttctttgaaaaaaactcggttcaatacttgaaatcaatt
caaaacgtctcacgggccttgatcgtcactgatcaatcgatggtcgaattcggttacgcc
gataaagtcatccgaaacttaccagcaggtgtcagctaccggattttcgaccaagtcgaa
ccggatccatccgtgacgaccgttcaagtcggagcccaagcgatgcgggacttccaaccc
gacttaatcatcgcccttggtgggggatctgcgatggatgcagcgaaaggcatgtggctg
ttctatgagcaaccaaatgagaagttctcaaacttacgtcaaaaattcctcgatatccgg
aaacgtgcttataaattcccggaactcggaaacaaagcgaagttcgtcgcgattccgacg
acgtcaggaacaggttctgaagtcacaccgttcacggtcatcacggacaaagagaaaaac
gtcaaatacccgattgctgactatgcgttgacaccagacgttgcgattgttgatccggag
ttcgtcatgacagtaccggcttcgatcacggcggatacagggatggacgtcctgactcac
gcaacggaagcgttcgtctcagtccttgcgaacgactacacggatggactggcgttaaaa
gcgatcaagatgatctttgactacttgccacgtgcttacgatgacggctcagacgccgaa
gcacgcgaaaaagtccacaatgcatccacgatggccggaatggcatttgcgaatgccttc
ctcggcatcaaccactcaatcgcccacaaaatcggtggggagttccacacaccacacggt
cggacaaatgcgattctgatgccgcacgtcatccgctacaatgcgacacgaccaacaaaa
ctggcagccttcccgaaatacgaatcgtttattgcggatgaacggtatgcggagatcgcc
cgttacctcggtctgccggcagcaacgacggaacaaggcgtcgaatcgtttatccaagcc
gtcagtgagctcggacaacgcctcaacatcaagatgtcgtttaaagcccaaggcatcaaa
aaagccgactttgaagcgaaactcgacaagatggcagtcgatgcgtttgaggatcaatgt
acaacagcgaatccgaaaatgccgctcgtgacggaactccgtcaaatcatggaatttgct
tacgaaggtatctaa

DBGET integrated database retrieval system