KEGG   Exiguobacterium antarcticum: Eab7_1181Help
Entry
Eab7_1181         CDS       T02258                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
ean  Exiguobacterium antarcticum
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ean00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Eab7_1181
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Eab7_1181
   00620 Pyruvate metabolism
    Eab7_1181
   00650 Butanoate metabolism
    Eab7_1181
  Lipid metabolism
   00071 Fatty acid degradation
    Eab7_1181
  Amino acid metabolism
   00350 Tyrosine metabolism
    Eab7_1181
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Eab7_1181
   00626 Naphthalene degradation
    Eab7_1181
Enzymes [BR:ean01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Eab7_1181
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Eab7_1181
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1202778..1205372
Genome map
AA seq 864 aa AA seqDB search
MAVKEKIKQDVSPVEQAINQIVAKGQTALQELLTFDQTKIDVIVRDMALAGLERHVELAR
LAVEETGRGVFEDKMIKNMFATEYIYNSLRDEKTVGILEEDVQNGITYIAEPVGVVCGVT
PVTNPTSTTMFKALIAIKTRNPIVFAFHPSAQQCSLEAAKTLRDAAVKAGAPQDCIQWVE
QPSLEATKVLMNHTDIAMVLATGGAGMVKSAYSTGKPALGVGPGNVPCYIEKSAKIKRAV
SDLVLSKTFDNGMICASEQAVIVDQEIYAEVRAEMEALGCYFCTADEKKRLEALVIKTDT
CAVNADIVGKPATWIAAKAGIEVPSNTVMLVAELEKVGTEEPLSHEKLSPVLGAYSVQST
EDAFHVAERMLEIGGLGHTAVIHTTNDDLMTAFGLRMKACRILVNSPSAHGGIGDLYNEL
TPSLTLGCGSYGKNSVSENVTAKHLLNIKKVARRRVNMQWFKVPEKIFFEKNSVQYLKSI
QNVSRALIVTDQSMVEFGYADKVIRNLPAGVSYRIFDQVEPDPSVTTVQVGAQAMRDFQP
DLIIALGGGSAMDAAKGMWLFYEQPNEKFSNLRQKFLDIRKRAYKFPELGNKAKFVAIPT
TSGTGSEVTPFTVITDKEKNVKYPIADYALTPDVAIVDPEFVMTVPASITADTGMDVLTH
ATEAFVSVLANDYTDGLALKAIKMIFDYLPRAYDDGSDAEAREKVHNASTMAGMAFANAF
LGINHSIAHKIGGEFHTPHGRTNAILMPHVIRYNATRPTKLAAFPKYESFIADERYAEIA
RYLGLPAATTEQGVESFIQAVSELGQRLNIKMSFKAQGIKKADFEAKLDKMAVDAFEDQC
TTANPKMPLVTELRQIMEFAYEGI
NT seq 2595 nt NT seq  +upstreamnt  +downstreamnt
atggctgtcaaagaaaaaatcaaacaagatgtctcacctgttgaacaagcaatcaatcaa
atcgtcgcgaaaggtcaaacggcgttacaagaactattaacatttgatcaaacgaaaatc
gatgtgatcgtccgggacatggcgcttgccggtctcgaacggcacgtcgaactcgcacga
cttgcggttgaagaaacaggacgtggtgtctttgaagataaaatgatcaaaaatatgttt
gcgacggaatatatctataacagtcttcgtgatgaaaaaacggtcggaattttagaagag
gatgtccaaaacggcatcacgtacatcgcagaaccggtcggtgtcgtctgtggcgtcaca
ccggtgacgaatccgacatcaacgacgatgttcaaagcgttgattgcgatcaaaacacgt
aacccgatcgtcttcgcgttccatccgtcagcacaacaatgttcgctcgaagcagcaaaa
acgttacgtgacgctgccgttaaagctggtgccccgcaagattgtatccagtgggtcgaa
caaccgtctcttgaagcaacaaaagtcttgatgaaccacaccgacatcgcgatggttctt
gcgacgggtggagccggcatggtcaaatcagcgtattcaaccggcaaaccggcacttggt
gttggaccagggaacgtaccgtgttacatcgaaaaatcagcaaaaattaagcgggccgtc
agtgatttggtcctctcgaaaacatttgataacggaatgatctgtgcctccgagcaagcg
gtcatcgtcgatcaagagatttatgcagaagtgcgggcagagatggaagcgctcggttgc
tacttctgtacagcagacgagaaaaaacgtcttgaagcacttgtcatcaaaaccgacaca
tgtgccgtcaatgcggacatcgtcgggaaaccggcaacatggatcgcagcgaaagcgggc
atcgaagtcccgagcaatacggtcatgctcgtcgccgaactcgaaaaagtcggcaccgaa
gaaccgctctcacatgaaaagctaagtcccgtccttggtgcctatagcgtccaatcaaca
gaagacgccttccacgtcgccgaacggatgcttgaaatcggtggtctcggtcacacggcg
gtcatccacacgacgaacgatgacttgatgacagcgttcggactccggatgaaagcctgc
cgaatccttgtcaacagcccgtcagcacacggtgggattggtgacttgtataacgaattg
actccatcgctgacacttggttgcggatcatacgggaaaaactcggtctctgaaaacgta
acggcgaaacatctactcaatatcaagaaggtggcgagacgacgcgtgaacatgcagtgg
ttcaaagtaccggaaaagattttctttgaaaaaaactcggttcaatacttgaaatcaatt
caaaacgtctcacgggccttgatcgtcactgatcaatcgatggtcgaattcggttacgcc
gataaagtcatccgaaacttaccagcaggtgtcagctaccggattttcgaccaagtcgaa
ccggatccatccgtgacgaccgttcaagtcggagcccaagcgatgcgggacttccaaccc
gacttaatcatcgcccttggtgggggatctgcgatggatgcagcgaaaggcatgtggctg
ttctatgagcaaccaaatgagaagttctcaaacttacgtcaaaaattcctcgatatccgg
aaacgtgcttataaattcccggaactcggaaacaaagcgaagttcgtcgcgattccgacg
acgtcaggaacaggttctgaagtcacaccgttcacggtcatcacggacaaagagaaaaac
gtcaaatacccgattgctgactatgcgttgacaccagacgttgcgattgttgatccggag
ttcgtcatgacagtaccggcttcgatcacggcggatacagggatggacgtcctgactcac
gcaacggaagcgttcgtctcagtccttgcgaacgactacacggatggactggcgttaaaa
gcgatcaagatgatctttgactacttgccacgtgcttacgatgacggctcagacgccgaa
gcacgcgaaaaagtccacaatgcatccacgatggccggaatggcatttgcgaatgccttc
ctcggcatcaaccactcaatcgcccacaaaatcggtggggagttccacacaccacacggt
cggacaaatgcgattctgatgccgcacgtcatccgctacaatgcgacacgaccaacaaaa
ctggcagccttcccgaaatacgaatcgtttattgcggatgaacggtatgcggagatcgcc
cgttacctcggtctgccggcagcaacgacggaacaaggcgtcgaatcgtttatccaagcc
gtcagtgagctcggacaacgcctcaacatcaagatgtcgtttaaagcccaaggcatcaaa
aaagccgactttgaagcgaaactcgacaagatggcagtcgatgcgtttgaggatcaatgt
acaacagcgaatccgaaaatgccgctcgtgacggaactccgtcaaatcatggaatttgct
tacgaaggtatctaa

DBGET integrated database retrieval system