KEGG   Exiguobacterium antarcticum: Eab7_1254Help
Entry
Eab7_1254         CDS       T02258                                 

Definition
glycoside hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ean  Exiguobacterium antarcticum
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ean00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Eab7_1254
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Eab7_1254
Enzymes [BR:ean01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Eab7_1254
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1263172..1265112
Genome map
AA seq 646 aa AA seqDB search
MGQKLNWTATLGLTTALLAASLPMQPVVAETTPSVTQRVDAQLEQMTLEQKIGQMIMPDF
RLWDGANHTKLAPEVGRVIDRFDLGGVILFAENVSETEQTTKLVHDLQEVVKQDTSNDIP
LFVTIDQEGGIVTRLGTGTNLPGNMALGATRSAAYAEAAGGIIGSELHALGINVNFGPVL
DVNNNPGNPVIGVRSFSNDPQLVGKLGSAMTQGIQEQGVAATAKHFPGHGDTAVDSHYGL
PVVDKSLKELKQLELVPFKRAIAEGIDMVMTGHIGMPQIEDEVVESTQGTFPLPATLSDD
VTTGVLREELGYQGLVITDALNMQAIADNFTESEAVIKTFKAGVDIALMPTILRSAQDVT
KLETIFDDVIEAVESGELLEADIDQSVSRILTLKATRGIWNETDTPVTLDEKLAQAKTVV
GSPEHKALERKMTEAAVTLVKNDKKTLPFKPKKGETILVLSPAKDQTDSMVKTIRSLEKN
VGNLKQVNVVTENYTASTPHLEQNPNLQEKLAAADYIIVGSNVNNSDKLKETSADHYVPA
EVFRQAKRTNTPSVLLSLRNPYDVAVQPDAGAQLLVYGFKGDPNGPDSEAGNTKSAGPNL
PAGIRAIFGEVKPQGKLPVDVPKFKDGTFRNTLHLEFGDGFKNWNR
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgggacagaaactcaactggacagcaacactcggattgacgacggcgttactcgccgcg
tcgctgccaatgcaaccggtcgtcgcggaaacgacaccatccgtcacgcaacgggtcgac
gcacaactggaacagatgacactcgagcagaagatcggtcaaatgatcatgccggatttc
cggttatgggacggggccaatcatacgaagctggcaccggaagtcggacgggtcatcgac
cggtttgacttagggggcgtcatcttatttgcggaaaacgtcagtgagacggaacagacg
acgaaactggtccatgacttgcaggaggtcgtcaagcaggatacaagcaacgatatccca
ttgttcgtgacgattgaccaggaaggcggcatcgtgacacgcctcggtacggggacgaat
ttgccgggtaatatggcactcggggcgacccgcagtgcggcttatgcggaagcggcaggc
ggaatcatcggctctgaactgcatgcactcggcatcaacgtcaactttggtccggtcctg
gacgtcaacaacaatccgggcaatcccgtcatcggagtccgttcgttttcaaatgatccg
cagctggtcgggaaactcggttcggcgatgacacaaggcattcaggagcaaggtgtcgct
gcgacggcaaaacacttcccgggacacggggatacggcagtagattcgcattatggcttg
ccggtcgtcgataaatcattaaaagagttaaagcaactggaactcgtcccctttaaacgg
gcaattgccgaaggaatcgatatggtcatgacgggacatatcgggatgccgcagatcgag
gatgaggtcgtcgaatcgacacaaggcacgttcccgttaccggcgacgttatcagatgac
gtcaccacaggcgtcttgcgggaagagctcgggtatcagggacttgtcattaccgatgcc
ttgaacatgcaagcgatcgctgacaacttcacggagtctgaagccgtcattaagacattt
aaagccggagtcgatatcgccttgatgccgacgattctccggtccgcgcaagacgtgacg
aaactcgagacgatttttgacgacgtgattgaagctgtcgaaagcggtgagctgttggaa
gcggacatcgatcagtctgtctcgcggattttgacgttaaaagcaacacgcggcatttgg
aatgaaacggacacaccggtcacgctcgatgaaaaactggcgcaagcaaaaacggtcgtc
ggcagtccagaacataaagcgctcgaacgcaaaatgacggaagcggcggtcacgctcgtc
aaaaatgacaagaaaacattgccgttcaaaccgaaaaaaggggaaacaatcctcgtcttg
tcacctgcaaaagatcagacggacagtatggtcaagacgatccggtcgcttgagaaaaat
gtcgggaacctgaagcaagttaacgtggtgacggaaaattacacggcatcgacgccgcat
ctggagcaaaatccgaatctgcaagaaaagttggctgctgcggactacatcatcgtcggc
tcgaacgtcaacaacagtgacaagttgaaagagacatcggcagaccattatgtaccagcg
gaagtgttccgtcaggcgaagcggaccaacacaccgtccgtcctgctcagtctccggaat
ccgtatgatgtcgccgtgcaaccggacgccggtgctcaactgctcgtttacggcttcaaa
ggggatccgaacggaccggattcggaagcggggaacacgaagtcagccggaccgaattta
ccggcaggaatccgcgccatctttggtgaagtgaaaccacaagggaaactgccggttgat
gtaccgaagttcaaagacggcacgttccggaacacacttcaccttgagtttggggacggg
ttcaagaactggaaccggtaa

DBGET integrated database retrieval system