KEGG   Exiguobacterium antarcticum: Eab7_1350Help
Entry
Eab7_1350         CDS       T02258                                 

Definition
glycosyl hydrolase family 1
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ean  Exiguobacterium antarcticum
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:ean00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Eab7_1350
Enzymes [BR:ean01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     Eab7_1350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1341322..1342782
Genome map
AA seq 486 aa AA seqDB search
MKTLPNDFLWGGALAAHQFEGGWNAGGKGPSTTSVMTAGEHGVARRITDTIEDGTFYPNH
EAIDFYHRYKEDIALFAEMGLKCLRTSIGWSRIFPNGDEMEPNEAGLKFYDDVFDELLKH
GIEPIITLSHFEMPLHLAREYGGFRNRKVAEFFERFAEVCFTRYKDKVTYWMTFNEINNK
MDVENPLFLWTNSGVKVEPGENAMEVMYQTGHHELIASALAVAKGKAINPDFQIGAMISH
VPIYPYSSHPEDVMLAEKSMRQRYFFPDVQARGYYPNYALKEFEREGYQIPILDGDDEIL
KNGTVDYIGFSYYMSTTVKHDATVNNTGNIVNGGLANGVENPYIQSSDWGWAIDPVGLRY
VLNRLYDRYQLPLFIVENGFGAVDTIEDGKIHDAARIDYLKTHIEALTEAVTEDGVELMG
YTPWGIIDIVSFTTGEMKKRYGMIYVDRDNEGNGSMERMKKDSFDWYKQVIATNGQDLAY
DKATQR
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgaagacattaccaaacgactttttatggggcggggcactggctgcccatcaatttgaa
ggcggctggaacgccggcggcaaaggaccaagtactactagtgtcatgacggcaggtgaa
cacggggtggcccgccggatcactgatacgattgaagacggcacgttttatccgaaccat
gaggcgattgatttttatcaccgctataaagaagacattgccttgtttgccgagatgggt
ctgaaatgtctccggacgtcgatcggctggagccggattttcccgaacggcgacgaaatg
gaaccaaacgaagccggattgaagttttatgatgatgtctttgacgaattgttaaaacac
ggcatcgaaccgatcatcacgttgtcgcacttcgagatgccgttgcatctggcccgtgaa
tacggcgggttccgcaaccggaaagtcgccgaattcttcgagcgattcgctgaagtctgc
ttcacacgttacaaagacaaagtgacgtactggatgacgttcaacgaaatcaacaacaag
atggatgttgagaatccgttgttcctctggacaaactccggtgtcaaagtcgagccgggt
gaaaatgcgatggaagtcatgtatcagaccggtcaccacgagttgatcgccagtgccctt
gccgtcgcgaaagggaaagcgatcaatcccgacttccaaatcggggcgatgatttcgcac
gtcccgatctatccgtactcatcgcatccggaagacgtcatgctggcggaaaaatcgatg
cgtcaacgctacttcttcccggacgtccaggcgcgcggttattatccgaactacgcctta
aaagagttcgaacgcgaagggtatcaaattccgattcttgacggggacgacgagattctg
aaaaacggaaccgtcgactatatcggcttcagttattacatgtcgacgaccgtcaaacac
gatgcgaccgtcaacaataccggcaacatcgtcaacggtggtcttgcgaacggtgttgag
aatccgtacatccagtcgagcgactggggttgggcgattgatccggtcggactccgttac
gtcttgaaccgtttgtatgaccggtatcaactcccgctcttcatcgtcgaaaacggcttt
ggggccgtcgatacgatcgaagacggcaagattcatgatgcggcgcggatcgattatctg
aagacgcatatcgaagcgttgacggaagcggtcacggaagacggcgtcgaattgatgggg
tacacaccgtggggcatcatcgacatcgtatcgtttacgacgggtgagatgaaaaaacgc
tacgggatgatttatgtcgaccgcgacaatgaaggcaacggttcaatggaacggatgaaa
aaggattcgttcgactggtacaaacaggtcatcgcgacaaacggacaagacttggcgtat
gacaaagcaacacaacgttaa

DBGET integrated database retrieval system