KEGG   Exiguobacterium antarcticum: Eab7_1742Help
Entry
Eab7_1742         CDS       T02258                                 

Gene name
sucC
Definition
(GenBank) Succinyl-CoA ligase [ADP-forming] subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ean  Exiguobacterium antarcticum
Pathway
ean00020  Citrate cycle (TCA cycle)
ean00640  Propanoate metabolism
ean00660  C5-Branched dibasic acid metabolism
ean01100  Metabolic pathways
ean01110  Biosynthesis of secondary metabolites
ean01120  Microbial metabolism in diverse environments
ean01130  Biosynthesis of antibiotics
ean01200  Carbon metabolism
Module
ean_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ean_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ean00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Eab7_1742 (sucC)
   00640 Propanoate metabolism
    Eab7_1742 (sucC)
   00660 C5-Branched dibasic acid metabolism
    Eab7_1742 (sucC)
Enzymes [BR:ean01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Eab7_1742 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: AFS70850
UniProt: K0ADD8
Position
complement(1698718..1699878)
Genome map
AA seq 386 aa AA seqDB search
MNVHEYQAKELLRSYGVPVPNGIAAFTVEEAVDAAEQLSGPIKVVKAQIHAGGRGKAGGV
KLAKSQEEVKEFATELLGKTLVTHQTGPEGKVIQRLLVEEGCAIDKEYYLGIVLDRVTGR
VVIMGSSEGGMDIEEVAEATPEKIIKEVVDPAVGLQAFQARKLAFAMGVPVKLVNKFVGM
VTKLYTFFVDKDCSIAEINPLVTTKDGDVLALDAKLNFDSNALYRHPDVVALRDESEEDP
REVEASKNDLNYIALDGNIGCLVNGAGLAMATMDIIKHFSGDPANFLDVGGGATKEKVTE
AFKLILSDENVKGIFVNIFGGIMKCDVIAEGIVAATKEVGLELPLVVRLEGTNVDAGKQI
LKDSGLAITAATSMADGAEKIAALVK
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtacatgaatatcaggcaaaagagttacttcgttcatacggtgtacccgttccg
aacggaattgcagcgtttacggtcgaagaggcagtcgatgcagcagaacaattgtcaggt
ccgatcaaagtcgtaaaagcacagattcacgcagggggtcgcggtaaagccggtggtgtt
aaattggctaaatcgcaagaagaagtgaaggaattcgcgacagagttactcggcaaaaca
ctcgtcacgcatcaaacaggtccagaaggtaaagtcatccaacgtcttcttgttgaagaa
ggttgtgcgattgataaagagtattatctcgggatcgtcctcgaccgtgtaacaggtcgt
gtcgtcatcatgggttcaagtgaaggcggaatggatattgaagaagtagcagaagcaacg
ccagaaaaaatcatcaaagaagtcgttgatccggcagtaggtctccaagcattccaagcg
cgtaaactcgcctttgcgatgggtgttcccgttaagctggtcaataaatttgttggtatg
gtgacgaaattgtacacgttcttcgtcgataaggattgttcaatcgctgaaatcaatcca
ctcgtcacaaccaaagatggtgatgtcttggcgcttgatgcaaaactcaactttgattca
aacgcactttaccgtcatccagatgtcgtcgcacttcgtgatgaatcagaagaagatcca
cgtgaagtcgaagcctctaaaaatgacttaaactatatcgcacttgatgggaacatcgga
tgtctcgtcaacggtgccggtcttgcaatggcgacgatggatatcattaaacactttagt
ggtgatccagcaaacttccttgatgtcggcggcggagcgactaaagaaaaagtaacagaa
gcattcaaattgattctatctgacgaaaatgtcaaaggaatcttcgtcaacatcttcggt
gggatcatgaagtgtgacgtcattgcagaaggtatcgttgcagcaacaaaagaggttggc
ttagaactaccgctcgtcgttcgtctagaagggacaaacgtcgacgcagggaaacaaatt
ctcaaagattcaggtctagcgattacagcagctacatcaatggcagacggcgcagaaaaa
attgctgcgctcgtgaagtaa

DBGET integrated database retrieval system