KEGG   Exiguobacterium antarcticum: Eab7_1945Help
Entry
Eab7_1945         CDS       T02258                                 

Gene name
ruvA
Definition
Holliday junction ATP-dependent DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
ean  Exiguobacterium antarcticum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ean00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Eab7_1945 (ruvA)
Enzymes [BR:ean01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Eab7_1945 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1896430..1897023)
Genome map
AA seq 197 aa AA seqDB search
MIEFVRGEVAYVCAEFVTIEVGGIGYKIVAPNPFFYRTGDEQVIVYTYHYVREDQEVLFG
FRSRRERALFTKLLGVTGIGPKGSLAIVASGDVDALVEAIEQEKESYLIKFPGVGKKTAK
QMTLDLKGKLAELAPDYIPSEGLFAQGNAELNEACEALTALGYSEREVEKVKKALQGEVL
STDQYVKRALQLLLNVR
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
gtgatagaattcgtacgcggcgaagtcgcttatgtctgtgcagaattcgtgacgatcgag
gtcggggggattggctacaaaatcgtagcaccgaacccgtttttttatcggaccggagac
gaacaggttatcgtatatacgtatcattatgtcagagaagaccaagaagtattattcgga
ttccgttcacgacgcgaacgagcactgttcacgaaattacttggtgtgaccgggattggt
ccaaaagggtcgctcgcgatcgtcgcatcgggtgatgtcgacgcgctggtcgaagcaatc
gaacaagaaaaagaaagttatctcattaaattcccgggtgtcgggaaaaagacggcgaaa
caaatgacgctcgatttaaaagggaagctggccgaactggcccctgattatattccgagt
gaaggattgttcgctcaaggaaatgccgaactaaatgaagcatgtgaagccttgacggca
cttggttacagtgaacgggaagtcgaaaaagtgaaaaaagcgcttcaaggtgaagtgctg
tcgaccgaccaatacgtgaagcgggcgctgcagttgttattgaatgtgaggtga

DBGET integrated database retrieval system