KEGG   Exiguobacterium antarcticum: Eab7_2023Help
Entry
Eab7_2023         CDS       T02258                                 

Gene name
murE
Definition
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
ean  Exiguobacterium antarcticum
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:ean00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:ean00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1977983..1979605)
Genome map
AA seq 540 aa AA seqDB search
MNRPYKHLSELIALFQLTCEEDPIVTSIETDSRQVTTGSLFICVRGYTVDGHQYAREATE
NGAVAILAEEPLEGMTVPVIVLSNTKQAAGQIADLFYDHPSRRLRVYGITGTNGKTTTTK
LTYDLFRSAGHKAGMISTVGAMIDGEIIDTPNTTPEAVILHRLLHQMVEQGVTDCVLEVS
SHALMEGRVEGVQFHAAAFTNLTHDHLDYHASMEEYAEAKALLFEQVATSGGKAVVLNEA
DPTSALMAKAANGVPVLWYATEEASDAPIAVEWQEETVRVRLDETVTEVPVFLLGDFNAA
NLAAAIGLIRAGEVNMYQLIRHIPELRLPKGRLERIPFEGCEIYIDYAHTPDGLEKCLKA
LSVPDEPLYVVLSAAGERDRSKRSIMGRIASQYCEGIIVTVHDTRREEPQQIIKELIKEI
PPRKIITCHETRKEALQIAAKIALTGKRVIIVGKGHERFERIGTEDVPFDETKILMEALK
PFIRTRVSDVKKPTDPGIMVGFVFLLMSGLFSYWQNEISSNLVDVLVHIVIAVKQPLDRL
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgtccatacaaacacttgtcagaattaattgccttatttcagcttacgtgtgag
gaagacccgatcgttacgagtatcgaaacagactcacgccaagtgacaacaggaagtttg
tttatttgtgtacgtggttacacggtagacgggcaccagtatgcacgagaagcaacagag
aacggtgcggtcgcgattttagcggaagagccgcttgaagggatgactgtcccggtcatc
gtgttatcgaatacaaaacaggcggctggacaaattgccgacttattttatgaccatcca
agccgacgactccgggtttacggcataacgggaacgaacggaaaaacgacgacgacgaaa
ttaacctatgatttattccgatccgctggacataaagctgggatgatcagtaccgttgga
gcgatgattgacggcgagataatcgatacgccgaatacaacaccggaagccgtcattctg
catcgtttattacatcaaatggtcgaacaaggtgtaacggattgtgtgttggaagtctcc
tcacacgccctcatggaaggacgggtcgaaggggttcagttccatgcggctgcctttacg
aatctgacacacgatcatctggattatcatgcgtcgatggaggaatatgctgaagcaaaa
gcgttgctgtttgaacaggtggcgacaagcggaggaaaagccgttgtcctgaacgaggca
gatccaacgagtgcactcatggctaaagctgcaaacggagtgccggtcctgtggtatgcg
acagaggaagcgtcagatgctccgattgctgtcgaatggcaggaggaaaccgttcgggta
cgcttggacgaaacagtcacggaagttccggtctttcttttaggtgacttcaatgccgcc
aatctcgcagcagcaatcggattgattagggcgggcgaagtcaacatgtaccaactgatt
cgacacatcccggaacttcgtttaccaaaaggaaggctcgagcggattccattcgaaggg
tgtgaaatttatatcgactatgcccatacgccggatggactggaaaaatgtttgaaagct
ttatctgttccggatgaaccgttatatgtcgtgttaagtgcagcaggagaacgggatcgt
tcgaaacgaagtatcatgggacgaattgcgagtcagtactgtgagggtatcatcgtgaca
gtccatgatacgagacgagaggaaccacagcagatcatcaaggaattgatcaaggaaatc
ccgccccgaaaaatcatcacgtgtcatgaaacacggaaagaagcgttgcagattgcggcc
aaaatcgccttgaccggaaaacgggttatcatcgtcggaaaagggcatgaacggtttgaa
cggatcggaacggaagatgttccgtttgatgaaacgaaaattttgatggaagctttaaaa
ccgtttatccggacaagagtcagcgatgtaaaaaaaccgaccgatcctgggatcatggtc
ggtttcgtttttctgctaatgtcagggcttttttcgtattggcaaaatgaaatttcgtcc
aatcttgtagacgtgttggtccatatcgtaatagcagtgaagcagccacttgatcgactt
tag

DBGET integrated database retrieval system