KEGG   Exiguobacterium antarcticum: Eab7_2058Help
Entry
Eab7_2058         CDS       T02258                                 

Gene name
pfkA
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ean  Exiguobacterium antarcticum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:ean00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Eab7_2058 (pfkA)
   01230 Biosynthesis of amino acids
    Eab7_2058 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Eab7_2058 (pfkA)
   00030 Pentose phosphate pathway
    Eab7_2058 (pfkA)
   00051 Fructose and mannose metabolism
    Eab7_2058 (pfkA)
   00052 Galactose metabolism
    Eab7_2058 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    Eab7_2058 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Eab7_2058 (pfkA)
Enzymes [BR:ean01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Eab7_2058 (pfkA)
Protein phosphatases and associated proteins [BR:ean01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Eab7_2058 (pfkA)
Messenger RNA biogenesis [BR:ean03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Eab7_2058 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2018524..2019492)
Genome map
AA seq 322 aa AA seqDB search
MSLKRIAVLTSGGDAPGMNAAVRAVTRKAIFHGLEVFGVYNGYQGLINGDLVQLNLGSVG
DIIQRGGTFLRSARCPEFRTEEGRAKAVVNLKKFEIDALVVVGGDGSYRGAQKLTGLGFP
TIGLPGTIDNDIPGTDFTIGFDTALNTALEAIDKIRDTASSHERTYVIEVMGRDAGDIAL
YAGLAGGAESILVPERPEDLKEVLNRIQSGVNRGKKHSIVIVAEGAGRAQDVGDEIAKET
GLDTRVTVLGHVQRGGAPTAADRVLASRMGAYAIDILLEGKQGRVVGVRGGKMIDLDIDE
ALDENKHELDLEILELSKQLSI
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
gtgagtttgaaacggattgctgttttaacaagtggtggtgacgcacccggcatgaatgcc
gcagtgcgtgctgtaacacgtaaggcgatttttcatggactagaagtatttggtgtctat
aacggatatcaaggtttgatcaatggagatctcgttcaattgaacttaggttcagttgga
gacatcattcaacgaggaggaacattcttacgttctgcccgttgcccagagttccggacc
gaagaagggcgcgcgaaagcggtcgtcaatctcaagaaatttgaaatcgatgcacttgtc
gtcgtaggtggtgacgggtcttatcgtggtgctcaaaaactgacgggtctagggttcccg
acgattggacttccaggaaccattgataacgatattccagggacggatttcaccattggt
tttgatacggcattaaatacagcacttgaagcgattgacaagattcgtgatacagcgtct
tcgcatgagcggacgtatgtcatcgaagtcatgggtcgcgatgcaggtgatatcgcattg
tatgccggactagcaggtggagcagaatcgattttagttccagaacgtcctgaagattta
aaagaagtattgaatcgaattcaaagtggtgtcaatcggggtaaaaaacactcgatcgtc
atcgtggcagaaggcgcgggtcgtgcgcaagatgtgggcgacgaaatcgcgaaggaaacg
ggtcttgatacacgtgttaccgtattaggtcatgttcagcgtggtggcgcaccaactgca
gccgaccgtgtgttagctagccggatgggggcatacgcaatcgacatcttactagaaggt
aagcaaggtcgtgtcgttggtgtccgtggtgggaaaatgattgatctcgacatcgatgaa
gcgttagatgagaacaaacatgaactggatcttgaaatcttagagttgtcgaaacaacta
tcgatttaa

DBGET integrated database retrieval system