KEGG   Exiguobacterium antarcticum: Eab7_2083Help
Entry
Eab7_2083         CDS       T02258                                 

Definition
AMP-dependent synthetase and ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ean  Exiguobacterium antarcticum
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ean00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Eab7_2083
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Eab7_2083
   00620 Pyruvate metabolism
    Eab7_2083
   00640 Propanoate metabolism
    Eab7_2083
  Energy metabolism
   00680 Methane metabolism
    Eab7_2083
Enzymes [BR:ean01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Eab7_2083
Lipid biosynthesis proteins [BR:ean01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Eab7_2083
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2046526..2048229)
Genome map
AA seq 567 aa AA seqDB search
MKVLKALPGKHWLSEYDGSDSYDWKEAEHYFSWATTGKVNMAYEAIDRHAEGERANKKAL
IYFDGTTEQTFTYADMKRLTNKAANVLKDAGIQAGDRIFIFMPRSPELYFALLGALKVGA
IVGPLFEAFMEQAVRDRLLDSEAKMLITTKALLPRVPVDELTSLEQIFLVDEEIKTNEKI
SDFRVAFEQASDVFEPVWLDREDGLILHYTSGSTGKPKGVLHVQNAMIQHMMTGRWVLDL
QEEDVYWCTADPGWVTGTSYGIFAPFLNGATNVVVGGRFNPDFWYSVIEKYKVTVWYSAP
TAFRMLMGAGAEIANTHDLSSLRHVLSVGEPLNPEVIRWGKEAFDQRIHDTWWMTETGAM
MICNYKSMDIKPGSMGKPIPGTQAAIVDDQGNELPPFRMGNLALKTPWPSMMRQIWNNPQ
KYDSYFFKGWYVSGDSAYMDDEGYFWFQGRVDDVIMTAGERVGPFEVESRLVEHPAVAEA
GVIGKPDPVRGEIIKAFISLRDGYEPTEELKQEIQKFVKEGLAAHAAPREIDFRDKLPKT
RSGKIMRRVLKAWELNLEAGDLSTMED
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttttgaaagcgcttccggggaagcattggttatccgaatatgatggatcagat
tcatatgattggaaagaagcagaacactatttttcatgggcgacgacggggaaagtcaat
atggcctatgaagcaatcgatcgtcatgcagaaggggaacgggcgaataaaaaagcgttg
atttattttgacgggacgacagaacagacctttacgtatgcggatatgaaacgattgacg
aataaagccgcaaacgtcctcaaagatgcgggaatccaagcaggagatcgaattttcatc
ttcatgccacgttcaccagaactgtattttgctctactaggtgccctgaaggttggagcc
atcgtaggtccgttgtttgaagctttcatggagcaagccgttcgggatcggttacttgat
tcagaagcaaaaatgttgattacgaccaaagccttgttgccacgtgttccggtggatgag
ttgacatccctcgaacaaatttttttagtggatgaagagattaaaacaaatgagaaaatt
tctgattttcgggttgctttcgaacaagcatcagatgtgtttgaaccggtctggctagac
cgagaagatggtttgatcttgcactacacatcaggttcgaccggaaaaccaaaaggtgtc
ctgcacgttcaaaatgcgatgattcagcatatgatgacgggacgttgggtgcttgatcta
caagaagaggatgtgtactggtgtaccgctgatccaggatgggtgaccggcacaagttac
ggtatctttgctccgtttttaaatggagcgacgaatgtggtcgtcgggggacggtttaat
ccggacttttggtatagtgtcatcgaaaaatataaagtgacagtctggtacagtgcacca
acggcattccggatgctgatgggagctggagctgaaattgcgaatacacacgatttatcc
agtctgcgccatgtcctctcagtcggggaaccacttaatccagaagtcatccggtggggg
aaagaagcgtttgaccaacggattcatgacacatggtggatgacagagaccggtgcgatg
atgatctgtaattataaatcgatggatattaaaccaggatcgatggggaaaccgattcca
ggtacgcaagccgcgattgtcgatgatcaaggaaatgaactccctccgttccgaatgggg
aatttagcactgaaaacaccatggccatcgatgatgcgtcaaatctggaacaatccgcaa
aaatatgattcgtatttctttaaaggctggtatgtctctggcgattctgcttatatggac
gatgaagggtacttctggttccaaggacgtgtggatgatgtcatcatgactgctggagaa
cgtgtcggaccgttcgaagtcgaaagccgactcgttgagcacccggctgtcgcagaggct
ggtgtcatcgggaaaccggatccggtacgtggtgaaatcatcaaagccttcatttcttta
cgggatggttatgaaccgaccgaagaattaaaacaagaaattcaaaaattcgtcaaagaa
gggctggcagcacatgcagcacctcgggaaattgacttccgggataaattgccgaaaaca
cgaagcggaaaaatcatgcgtcgtgtcttaaaggcctgggaattgaatcttgaagcgggt
gacctttcgacgatggaagattga

  All links  
No link information was found.   
DBGET integrated database retrieval system