KEGG   Exiguobacterium antarcticum: Eab7_2238Help
Entry
Eab7_2238         CDS       T02258                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ean  Exiguobacterium antarcticum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ean00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Eab7_2238 (tpiA)
   01230 Biosynthesis of amino acids
    Eab7_2238 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Eab7_2238 (tpiA)
   00051 Fructose and mannose metabolism
    Eab7_2238 (tpiA)
   00562 Inositol phosphate metabolism
    Eab7_2238 (tpiA)
Enzymes [BR:ean01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Eab7_2238 (tpiA)
Exosome [BR:ean04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Eab7_2238 (tpiA)
  Exosomal proteins of bladder cancer cells
   Eab7_2238 (tpiA)
  Exosomal proteins of melanoma cells
   Eab7_2238 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2193520..2194272)
Genome map
AA seq 250 aa AA seqDB search
MRKPIIAGNWKMNLSLKDAVAFAEEVKGTVPASSKVDAAVCAPSVFLAHLTEAAAGTDLK
IGAQNMYDQESGAYTGEISPVMLKDLGVTYVILGHSERREYFGETDAFINSKAKKAFEHG
LVPIVCVGETLEQREGGQFESVIREQTANSLKGLTVDQVKNLVVAYEPVWAIGTGKSATE
QDAQDSCKFVRDVVAAEFGTEAAEAVRIQYGGSVKPENIKEYMAQPDIDGALVGGASLET
GSFLKLLEAI
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaccaattatcgcaggtaactggaagatgaatcttagcctcaaggatgctgtc
gcattcgctgaggaagtcaaaggaactgtacccgcttcttcgaaagtcgacgcggctgtc
tgtgcaccgtctgtattccttgcacatttgacagaagcagcagctggaacagacttgaaa
atcggcgctcaaaacatgtatgaccaagaaagcggcgcatatacaggcgaaatcagcccg
gtcatgctgaaagatcttggcgtgacatacgtcatcctcggtcattcagaacgccgtgaa
tactttggtgaaacagatgcgttcatcaacagcaaagcgaaaaaagcattcgaacacggt
ctcgtgccaatcgtttgtgtcggtgaaacactcgaacaacgcgaaggcggtcaattcgag
tcagtcatccgcgaacaaacggcaaacagccttaaaggattaacagtcgatcaagtgaaa
aaccttgttgtcgcatacgagcctgtctgggcaatcggaacaggcaaatcagcgacagaa
caagatgcacaagattcttgtaaattcgttcgtgacgtcgtcgcggctgaattcggtact
gaagcagctgaagcggtccgtatccagtacggtggcagtgtcaaaccggaaaacatcaaa
gaatatatggctcaacctgacatcgacggtgctctagttggtggcgcaagtcttgagaca
ggatcgttcctcaaactgttggaggcgatttaa

DBGET integrated database retrieval system