KEGG   Exiguobacterium antarcticum: Eab7_2442Help
Entry
Eab7_2442         CDS       T02258                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ean  Exiguobacterium antarcticum
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ean00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Eab7_2442
   00052 Galactose metabolism
    Eab7_2442
   00500 Starch and sucrose metabolism
    Eab7_2442
   00520 Amino sugar and nucleotide sugar metabolism
    Eab7_2442
Enzymes [BR:ean01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Eab7_2442
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2408440..2409330)
Genome map
AA seq 296 aa AA seqDB search
MNKKVKKAVIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIIEEAIESGIEDILIITGK
GKRAIEDHFDSVPELEANLIAKNKSELLHLVEATTNINIHFIRQSKPKGLGDAILQAKAF
IGNEPFVVMLGDDIVQADVPCTRQLIEQYEITNSSIIGVQPVADKDTHRYGIVDPSTSIT
DQLHKVKSFVEKPLPGTAPSNLAILGRYLLTPEIFKYLETQEVGSGGEIQLTDAITRLNE
MQRVFAYEFDGKRYDVGEKLGFIRTTLEFALKREDLGDDVREMMYELLDLKIPVTE
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaaagtaaaaaaagcagttattccagcggctggtcttggaactcgtttttta
cctgcgacaaaagcaatgccgaaagagatgttaccaatcgtcgataaaccaacgattcaa
tatattatcgaagaagcaattgaatcaggaatagaggatatactaattatcaccggaaaa
ggcaagcgagcaatcgaagatcattttgattcagtaccagagcttgaagcaaatttaata
gcgaaaaataaatcagagttgctacatttggtagaagcgacaacaaacatcaatattcat
tttattcgtcaatccaagccgaaagggttaggggacgcgattctacaagcaaaagcgttt
attggtaatgaaccatttgtcgttatgcttggagacgatatcgttcaagcggatgtaccg
tgtacacgacaattgattgaacagtatgagattacaaacagttcaatcattggcgttcaa
ccagttgcggataaagatacgcatcgttacggtattgtcgatccaagtacaagcatcacg
gatcagttacataaggtgaaatcatttgttgaaaaacctttaccaggaacggcaccatca
aacctggctattttaggtcgttatctgttgacgccagaaatcttcaagtacttagaaaca
caagaagttggatcaggcggcgagattcaattgacagatgcgattacacgactcaatgaa
atgcaacgggtatttgcctacgaatttgatggcaaacgatacgacgttggagaaaaatta
ggttttattcgtacaacacttgaattcgcattgaaacgtgaagatttaggtgacgatgta
cgtgaaatgatgtacgaacttttagatttaaaaattccagtaactgaataa

DBGET integrated database retrieval system