KEGG   Exiguobacterium antarcticum: Eab7_2519Help
Entry
Eab7_2519         CDS       T02258                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
ean  Exiguobacterium antarcticum
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:ean00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Eab7_2519
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Eab7_2519
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Eab7_2519
Enzymes [BR:ean01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Eab7_2519
Exosome [BR:ean04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Eab7_2519
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2486179..2487537
Genome map
AA seq 452 aa AA seqDB search
MKLKRIIPILALSTLSLSTMVSMNEAEAKTKQPKSPEIRNVIFLIGDGMGVSYTSAHRYL
KNDPSTPLAEKTAFDQYLVGQQMTYPEDPEQNVTDSASAATAMSSGVKTYNAAIAVDNDK
SEVKTVLETAKERGKSTGLVATSEITHATPASFGAHDENRKNMNAIADDYFKERVNGKHK
IDVLLGGGKSNFVRPDVDLTKSFKKDGYSYVTDLDQMQADKNKQVLGLFADGGLPKRIDR
ENTVPSLEQMTNSAIKRLDSNKKGFFLMVEGSQIDWAGHDNDIVGAMSEMEDFERAFKAA
IAFAKKDKHTLVVATADHSTGGYSIGADGIYNWFAEPIKAAKKTPDFMAAKIVGGADVRQ
TLTTYIDQNRLALTEEEIQSVSRAAESKKVLDVDNAIEAIFNERSHTGWTTGGHTGEDVP
VYAFGPAKERFAGQVDNTDHAKIIFDLLKSKK
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgaagttaaaacgaatcattcctattcttgcgttatccacactgtcccttagcacgatg
gtctcgatgaacgaggccgaggcgaagacgaaacaaccaaaatcaccggaaatccgcaac
gtcatcttcttgatcggggacggaatgggcgtctcgtatacgtctgcccaccgctactta
aaaaatgatccttcgacgccactcgctgaaaaaacagcatttgatcaatatctcgtcgga
caacagatgacctatccggaagacccggagcaaaatgtcaccgactcggcgtctgccgcg
acggcaatgtcgtccggtgtcaaaacatataatgcggcgattgctgtcgacaacgataaa
tcagaagtcaagacggtccttgaaacggcgaaagagcgcgggaaatcaacgggtctcgtc
gcaacatccgaaatcacgcatgcgacaccggcctcgttcggtgcgcatgatgagaaccgc
aagaacatgaacgccatcgctgacgattattttaaggagcgggtcaacggcaaacacaaa
attgacgtcctccttggcggcgggaaatcgaacttcgtccgtccggatgtcgatttgacg
aaatcgttcaagaaagatggttacagctacgtcacggatcttgatcaaatgcaggcggat
aagaacaaacaagttctgggtctgttcgcggacggcggactgccaaaacgaatcgaccgc
gagaacaccgtcccgtctctcgagcagatgacgaactcggccatcaaacgtctcgattcg
aacaaaaaaggcttcttcctgatggtcgaaggaagccaaatcgactgggcgggtcacgat
aacgacatcgtcggagcaatgagtgagatggaagacttcgaacgtgccttcaaagccgcg
atcgctttcgcgaaaaaagataaacacacactcgtcgtcgcgacagccgatcactcgacc
ggtggttactcaatcggagcagacggcatctacaactggttcgccgagccgatcaaggca
gcgaaaaagacgccggacttcatggcagcgaaaatcgttggtggagcggatgtccgtcag
acgttaacgacgtacatcgaccaaaaccgactcgccttgacggaggaagagatccagtcg
gtctcacgtgccgcggaatcaaagaaagtcctcgacgtcgataatgcgatcgaagccatc
ttcaatgaacggtcgcacacgggctggacgacaggtggtcacactggtgaagacgtccct
gtttatgccttcggtccagcgaaagaacgattcgccggtcaagtcgataatacggatcac
gcgaaaatcatcttcgacctgttgaaatcgaagaaataa

DBGET integrated database retrieval system