KEGG   Exiguobacterium antarcticum: Eab7_2531Help
Entry
Eab7_2531         CDS       T02258                                 

Definition
(GenBank) Esterase
  KO
K03928  carboxylesterase [EC:3.1.1.1]
Organism
ean  Exiguobacterium antarcticum
Brite
Enzymes [BR:ean01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Eab7_2531
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Abhydrolase_1 DLH Abhydrolase_2 BAAT_C Chlorophyllase2 FSH1 UPF0227 Lipase_3 Esterase
Motif
Other DBs
NCBI-ProteinID: AFS71620
UniProt: K0AFI3
Position
2499144..2499902
Genome map
AA seq 252 aa AA seqDB search
MSMLYPVLPGADAFLLERGSVGILLCHGFNATPQSVRAVGERFAEHGFTVHAPRLAGHGT
DLRDFAASTAEDWKQSVREGFDLLAKQCPSIFIVGQSMGATLALALATEGLPVDGIITIN
AALSVPAYEALSFDDCPDQLPESAPDIKRPAFEIIYDFVPTTCAAELLRLIRDTVPDLPT
LQIPTLILYSVEDHVVPSSCSDYLHRTISSVDKRTYCLLNSYHVATLDYDQEAIVEETIR
FVEQFSRLTETG
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgagtatgctttatcctgttttaccaggggctgatgcctttttattagaacgtggatcc
gtcgggattctgttgtgtcatggttttaacgcaacaccacaaagtgttcgtgctgtaggc
gaacgcttcgcagaacatggtttcaccgtccatgcacctcgcttagcgggtcacggaacc
gacctccgtgactttgccgcttcgactgctgaagactggaaacaaagtgtccgcgaaggg
tttgacctgttagccaaacagtgtccatccatcttcatcgtcggtcaatcgatgggggcg
acgctcgccttagcactcgccaccgaaggattgccggtcgatggcatcatcacgatcaac
gcagccctgtccgtcccagcgtacgaagcgttatcgttcgatgattgtccggaccaactg
cctgaaagcgcccccgatatcaaacgtccggcttttgaaatcatttatgatttcgtcccg
accacgtgtgcagcagaactgttacgcttgatccgggacacggttcccgacttacctaca
cttcaaattcccacccttattttatattctgtggaagatcacgtcgtcccatccagttgc
tccgattacctgcaccggacaatcagctcggtcgacaaacgtacgtattgtctgctcaat
tcgtatcatgtcgcgacgctcgattacgaccaagaggcaattgtggaggagacgatccga
ttcgtcgaacagttcagccggttgaccgagacgggttga

DBGET integrated database retrieval system