KEGG   Exiguobacterium antarcticum: Eab7_2531Help
Entry
Eab7_2531         CDS       T02258                                 

Definition
Esterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
ean  Exiguobacterium antarcticum
Brite
Enzymes [BR:ean01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Eab7_2531
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2499144..2499902
Genome map
AA seq 252 aa AA seqDB search
MSMLYPVLPGADAFLLERGSVGILLCHGFNATPQSVRAVGERFAEHGFTVHAPRLAGHGT
DLRDFAASTAEDWKQSVREGFDLLAKQCPSIFIVGQSMGATLALALATEGLPVDGIITIN
AALSVPAYEALSFDDCPDQLPESAPDIKRPAFEIIYDFVPTTCAAELLRLIRDTVPDLPT
LQIPTLILYSVEDHVVPSSCSDYLHRTISSVDKRTYCLLNSYHVATLDYDQEAIVEETIR
FVEQFSRLTETG
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgagtatgctttatcctgttttaccaggggctgatgcctttttattagaacgtggatcc
gtcgggattctgttgtgtcatggttttaacgcaacaccacaaagtgttcgtgctgtaggc
gaacgcttcgcagaacatggtttcaccgtccatgcacctcgcttagcgggtcacggaacc
gacctccgtgactttgccgcttcgactgctgaagactggaaacaaagtgtccgcgaaggg
tttgacctgttagccaaacagtgtccatccatcttcatcgtcggtcaatcgatgggggcg
acgctcgccttagcactcgccaccgaaggattgccggtcgatggcatcatcacgatcaac
gcagccctgtccgtcccagcgtacgaagcgttatcgttcgatgattgtccggaccaactg
cctgaaagcgcccccgatatcaaacgtccggcttttgaaatcatttatgatttcgtcccg
accacgtgtgcagcagaactgttacgcttgatccgggacacggttcccgacttacctaca
cttcaaattcccacccttattttatattctgtggaagatcacgtcgtcccatccagttgc
tccgattacctgcaccggacaatcagctcggtcgacaaacgtacgtattgtctgctcaat
tcgtatcatgtcgcgacgctcgattacgaccaagaggcaattgtggaggagacgatccga
ttcgtcgaacagttcagccggttgaccgagacgggttga

DBGET integrated database retrieval system