KEGG   Exiguobacterium antarcticum: Eab7_2666Help
Entry
Eab7_2666         CDS       T02258                                 

Definition
(GenBank) 3-hydroxybutyrate dehydrogenase
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
ean  Exiguobacterium antarcticum
Pathway
ean00072  Synthesis and degradation of ketone bodies
ean00650  Butanoate metabolism
ean01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ean00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Eab7_2666
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Eab7_2666
Enzymes [BR:ean01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Eab7_2666
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Polysacc_synt_2 Epimerase 3HCDH_N Methyltransf_25 TrkA_N Methyltransf_31 Methyltransf_11 GDP_Man_Dehyd DFP 3Beta_HSD Methyltransf_23 NAD_binding_7 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AFS71751
UniProt: K0AGZ0
Position
complement(2630587..2631369)
Genome map
AA seq 260 aa AA seqDB search
MKQLEGKVALITGAASGIGLEIAEEFAQEGAKVVIVDLQEDAAKQAAEALQSKGFEAFAV
AGDVTSEVAIQSSIEQTMSHYGRIDIVINNAGMQHVSPIEEFSTEKFDLLQSIMLRAPFL
YTKYVFPIMKKQGFGRILNMSSINGLIGFAGKAAYNSAKHGVIGLTKVAALEGATSGITV
NAICPGYVDTPLVQKQLSSLAETRNVPLDRVLEEVIYPLVPQHRLLQVKEIADYAIFLAS
DKAAGVTGQAVVLDGGYTAQ
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaacttgaaggaaaagtagccttgattacgggagcagcgagtgggattggtctt
gaaatcgcggaagaatttgcccaagaaggcgcaaaagtcgtcatcgtcgatttacaagag
gacgctgcgaaacaagcggcggaggcactccaaagtaaaggattcgaagcctttgccgta
gcgggggatgtgacgagcgaagtcgccatccagtcgagcatcgaacagacgatgagccat
tacggacgcatcgatatcgtcatcaataatgccgggatgcaacacgtctcaccaatcgaa
gaattctcgactgaaaaattcgacttactgcaaagcatcatgttacgggcaccgttcctt
tatacgaaatatgttttcccgatcatgaaaaaacagggattcggtcgaatcttaaatatg
tcatcgattaatggactgatcggatttgccggtaaagcggcttacaatagcgcaaaacac
ggcgtcatcggcttgacgaaggtcgcagcactggaaggtgcaacgtccggcattaccgtc
aatgcgatttgcccgggttatgtcgatacgccactcgttcaaaaacaattgtcttctctc
gcagagacacgcaacgtgccgctcgaccgtgtacttgaagaagtcatctatccgttggtg
ccacaacaccgcttattacaagtaaaagaaatcgcggactatgcgatcttcttagcaagt
gataaagcggcgggtgtgaccggtcaagccgttgtgcttgatggtggttatacggctcaa
taa

DBGET integrated database retrieval system