KEGG   Exiguobacterium antarcticum: Eab7_2795Help
Entry
Eab7_2795         CDS       T02258                                 

Definition
acetylornithine deacetylase or succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
ean  Exiguobacterium antarcticum
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ean00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Eab7_2795
  Amino acid metabolism
   00300 Lysine biosynthesis
    Eab7_2795
Enzymes [BR:ean01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Eab7_2795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2754205..2755362
Genome map
AA seq 385 aa AA seqDB search
MLTEPITYLQRCLQIPSTNPLDGEENSAVYVYDLLTSHGVETEWIEVSPKRICLVATIQA
GASAIEPKTIGFSGHLDTVPVKISEWTTDPFGGNIEDGRIYGRGASDMKSGVMALVSMML
DLNTRTDLPNHLKLLITSDEENGMTGARHLTERGDADDLDALLITEPTSGFLGYAQKGVI
GVEVSCTGKSAHSSSPQLGKNAIDDLYRVIREIKSDRYAITNHSHPELGPVVASITSITG
GEGPNVIPSHAAFYLDIRTIPGFGREQVLQALEEVNQRLRQQDDSFSMEVTVIKDIPSCE
TDRDDPFLQIVADTMESIRQQPTQRVAIPGGTDGAMFSQAARSFPIAVASFHDFRLAHQI
DESIPLSEYAETIELCMRLALHSYD
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgctgacagaaccgattacttatttgcaacgctgtttacagatcccaagcaccaatcca
ctcgacggggaagagaactccgccgtgtacgtctatgatctcttgacgtctcacggggtt
gagaccgaatggatcgaggtatcaccgaaacggatttgccttgttgctacgattcaggcc
ggtgcttctgccattgaaccgaaaacgatcggcttctccggtcatctcgatacggtcccg
gtcaaaatcagcgagtggacgacagatccgttcggaggtaacattgaggacggacggatc
tacggacgcggtgcctccgacatgaagtccggtgtcatggcgcttgtcagtatgatgctt
gatttaaatacacggaccgacttaccaaatcacctgaagttattgattacgtcggatgaa
gaaaacgggatgaccggagcccgccatttgaccgagcgtggtgacgcagatgatttagac
gctctgttgatcacagaaccgacaagcggttttcttggttacgcgcaaaaaggggtcatc
ggcgtggaagtgtcgtgtacgggaaaaagtgcacacagttcttcgccccaactcggcaaa
aacgcgattgatgatctgtatcgtgtgattcgagaaatcaaatccgatcgttatgcgatc
accaatcatagtcatccggaacttggacccgtcgtcgcttccatcacatcaatcacaggc
ggggaaggtcccaacgtcattccgagccatgctgctttttatctggacatccggacgatt
cccggatttggacgggaacaggtcttgcaggcgctcgaagaagttaaccaacggctgcgt
caacaggacgacagcttctcgatggaagtcacggtcatcaaggacatcccctcctgtgag
accgatcgtgacgatccgttcttacaaattgttgcggacacgatggaatcaatccggcag
cagccgacacagcgcgtcgcgattcctggcgggacagacggtgccatgttcagccaggcc
gcccggagcttcccgattgcggtggcttcgttccacgatttccggctggcccatcaaatc
gatgagtcgattcccctgtcggaatatgcggaaacgatcgagttgtgtatgcgtcttgcg
ctacattcctatgactga

DBGET integrated database retrieval system