KEGG   Enterobacter aerogenes EA1509E: ST548_p3631Help
Entry
ST548_p3631       CDS       T02447                                 

Definition
Thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
ear  Enterobacter aerogenes EA1509E
Brite
Enzymes [BR:ear01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     ST548_p3631
Secretion system [BR:ear02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   ST548_p3631
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4796652..4797365
Genome map
AA seq 237 aa AA seqDB search
MKKGLLMFTLLAASLSGAAHADSAAIKQSLAKLGVQSTDIQPSPVSGMSTVLTDSGVLYV
TDDGKHIIQGPMYDVSGAQPVNVTNQLLVGKLNALTKEMIVYKAPKEQHVITVFTDITCG
YCHKLHEQMSDYNALGITVRYLAFPRQGLQSQAEQDMKAIWCAKDRNKALDDAMNGKGVQ
PASCSVDIAKHYTLGVQMGVNGTPAMVLSNGMVLPGYQGPKELKAFLDEHQKQTSGN
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaggtttattgatgttcaccctgctggcggcttcactctccggcgcggcgcat
gccgatagcgcggcgatcaaacagtcgctggcgaaactgggtgtgcagagcaccgatatc
caaccgtcgccggtttccgggatgagcacggtgctcaccgacagcggcgtgctgtacgtc
actgacgatggcaaacacattattcaggggccaatgtacgacgtcagcggcgcgcagccg
gttaacgtcaccaaccagttgctggtcggcaagctgaacgccttaaccaaagagatgatt
gtctataaagcgccgaaggagcagcatgtcattaccgtctttaccgacatcacctgcggc
tactgccataaactgcacgagcagatgagcgactataacgcgctggggatcaccgtgcgc
tatctggccttcccgcgccaggggctgcaaagccaggccgagcaggacatgaaagcgatc
tggtgtgcgaaagatcgcaacaaagcgctggatgacgccatgaatggtaagggcgtgcag
ccggcgagctgcagcgtagatatcgccaaacattataccctcggggtgcaaatgggcgtc
aacggcaccccggcgatggttctcagcaacggcatggtgctgccgggctatcaggggccg
aaagagcttaaagctttcctcgacgagcatcaaaaacagacaagcggtaactga

DBGET integrated database retrieval system