KEGG   Enterobacter aerogenes EA1509E: ST548_p4128Help
Entry
ST548_p4128       CDS       T02447                                 

Definition
4-alpha-glucanotransferase (amylomaltase) (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ear  Enterobacter aerogenes EA1509E
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ear00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ST548_p4128
Enzymes [BR:ear01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     ST548_p4128
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4310109..4312184
Genome map
AA seq 691 aa AA seqDB search
MENKRLDNAALAAGISPSYINAHGQPQSIAAATKQRLLDAMHRTSTAAKAAVEPLPSVKV
FTHGKKMQLPVAGSGAFHWLLTTEEGKQYQGETRGGETLALPGRLPTGYHTLTLTRDGER
WHCRAIVAPARCYEPQALKEGKKLWGACVQLYTLRSENNWGIGDFGDLRAMLPEIARRGG
AFIGLNPIHALYPANPESASPYSPSSRRWLNVIYIDVNAVEDFQRSPAAQAWWQLAETQQ
ALQAARQTADVDYTAVTALKLTALRLAWAEFSTREDKQMAEFRQFVLREGESLYWQAAFD
ALHAWQSRQDPMRWGWPAWPEAYQSTSSPQVKTFCAEHADEVSFYLWLQWLAYTQFAACW
HTSQQDGMPIGLYRDLAVGVAEGGSETWCDRELYCLKASVGAPPDILGPLGQNWGLPPMD
PHVMVARAYEPFIELLRANMQNCGALRIDHVMSVLRLWWIPYGETADHGAYVQYPVDDLL
AILALESQRHRCMVIGEDLGTVPVEIVGKLRKSGVYSYKVLYFENGPDKTFRAPKAYPQQ
SMAVATTHDLPTLRGYWESGDLTLGKTLGLYPDEVVLRGLYADREQAKQGLLDALHRHGC
LPKRAGHKASLMAMTSTLNRGMQRYIADSNSALLGLQPEDWLEMASPVNIPGTSTEYPNW
RRKLSVTLEQMFADAQVNKLIKDLDKRRKAR
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atggagaataaacgccttgataatgccgcgctggcggcggggatcagccccagctatatc
aacgcgcacggccagccgcagtcgatcgcggcggccaccaaacaacgtttgctggatgct
atgcatcgtacgtctactgccgcgaaagcggcagtagaaccgctgcccagcgtcaaggtt
tttactcacggtaaaaaaatgcagttgccggtagcgggaagcggcgcgtttcactggctg
ctgacgaccgaagaaggtaagcagtatcagggtgagacgcgcggcggcgaaacgctcgct
ttgcctgggcgattgccgacgggctatcacaccctgaccctcacgcgggacggcgaacgc
tggcactgccgggcgatcgtcgccccggcgcgttgctacgaaccgcaggcgctaaaagag
ggcaaaaagctatggggcgcctgcgtccagctctacaccctgcgttctgagaacaactgg
ggcattggcgacttcggcgatctacgcgccatgctgccggaaatcgcccgtcgcggcggc
gcgtttatcggcctcaacccgattcacgcgctctatccggcgaacccggagagcgccagt
ccgtacagtccgtcctcgcgccgctggcttaacgtcatctatatcgacgttaacgcggtg
gaggatttccagcgtagccctgccgcgcaggcatggtggcagcttgcggaaacccagcag
gccttgcaggccgcgcggcagaccgctgatgtcgactataccgctgtcaccgcgctgaag
ctgaccgcgctgcgtctggcgtgggccgagttttctacgcgtgaagataagcaaatggcg
gagttccgtcagttcgtgctgcgcgagggcgaaagtctctactggcaggcggcgtttgat
gcgctgcatgcctggcaaagccgtcaggatccgatgcgctggggctggccggcatggccg
gaagcgtatcagagcacgagcagcccgcaggtgaaaaccttctgtgcggagcatgccgat
gaggtgagcttttatctatggctgcagtggctggcatatacgcagttcgccgcctgttgg
cacaccagccagcaggacgggatgccgattggcctgtatcgcgatctggcggtcggcgtc
gccgaaggcggatcggagacgtggtgcgatcgcgagctgtattgcctcaaggcttccgtc
ggcgcgccgccggacatcctcggcccgctgggacagaactggggcctgccgccgatggat
ccgcatgtaatggttgcccgcgcctacgagccgtttatcgaactgctacgggcgaatatg
caaaactgcggcgcattgcgtattgaccacgtgatgtcggtgctgcgtttgtggtggata
ccgtatggcgaaaccgccgaccatggcgcctatgtgcagtatcccgtggatgacctgctg
gcgatcctggcgctggagagccagcggcaccgctgcatggtcattggcgaagacctcggt
accgtaccggttgaaatcgtcggcaagctgcgcaaaagcggtgtttactcgtataaagtg
ctctatttcgaaaatggccctgataaaacgttccgcgcgccgaaggcttatccacagcag
tcgatggcggtcgcaacgacccacgatctcccgacgctgcgcggctattgggagagcggt
gatttgacgctcgggaagacgctgggtctgtatccggatgaagtggtgctgcgcggctta
tatgccgatcgcgaacaagcaaagcaggggttgctggatgcgctgcatcggcacggctgt
ttgccgaagcgcgccggacataaagcctcgctgatggcgatgacctcaacgctcaatcgc
gggatgcagcgctacatcgccgacagcaacagcgccctgcttgggctgcagccggaagat
tggctggagatggcttcgccagtcaacatcccgggcaccagtaccgagtatcccaactgg
cggcgtaagcttagtgtgacgctcgagcagatgtttgccgatgcgcaggtgaataagctg
attaaagatctggataagcgccgcaaagcccgctaa

DBGET integrated database retrieval system