KEGG   Enterobacter aerogenes EA1509E: ST548_p4139Help
Entry
ST548_p4139       CDS       T02447                                 

Definition
1,4-alpha-glucan (glycogen) branching enzyme, GH-13-type (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
ear  Enterobacter aerogenes EA1509E
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:ear00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ST548_p4139
Enzymes [BR:ear01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     ST548_p4139
Exosome [BR:ear04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ST548_p4139
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4291152..4293335
Genome map
AA seq 727 aa AA seqDB search
MSNRIDRDVINALIAGHFADPFSVLGMHRTEAGLEVRALLPDATEVWVIEPKTGRKVGKL
ECLDSRGFFSGMLPRRKNAFRYQLAVTWHGQQNLIDDPYRFGPLLQDVDAWLLSEGTHLR
PYETLGAHADTMDGVTGTRFSVWAPNARRVSVVGQFNYWDGRRHPMRLRKESGIWELFIP
GALNGQLYKFELIDAHGNLRVKADPYAFESQMRPESASLICDLPPKVEQPAARKAANQFD
APISIYEVHLGSWRRHTDNNFWLSYRELADQLVPYAKWMGFTHLELLPVNEHPFDGSWGY
QPTGLYAPTRRFGTREDFRYFIDAAHAAGLNVILDWVPGHFPADDFALASFDGTSLYEHS
DPREGYHQDWNTLIYNYGRREVSNYLVGNALYWIERFGIDALRVDAVASMIYRDYSRKAG
EWIPNEYGGRENLEAIEFLRNTNRILGEQTPGAVTMAEESTDFAGVTRPPADGGLGFWFK
WNLGWMHDTLDYMKLDPVHRRYHHDKMTFGMLYNYTENFVLPLSHDEVVHGKKSILDRMP
GDAWQRFANLRAYYGWLFAFPGKKLLFMGNEFAQGREWNHDASLDWHLLEGGDNWHHGVQ
RLVRDLNHTYRHHKALHELDFDPYGFEWLVVDDHERSVFIFVRRDKAGNEIIVASNFTPV
PRHNYRFGINQPGRWREELNTDSMHYHGSNAGNGGVVESESVASHGRQHSLSITLPPLAT
IWLVREA
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaatcgaatcgatagagacgtgattaatgcgcttattgcaggtcatttcgcggat
cccttttccgtgcttggcatgcaccgcaccgaggcggggctggaagttcgcgcattatta
ccagatgccaccgaagtgtgggttattgaaccgaaaaccgggcgtaaagtcggcaaactc
gaatgcctcgactcgcgcggattctttagcggcatgctgccgcggcgtaaaaacgctttt
cgctaccagctggccgtcacctggcacggacagcaaaacctgattgacgacccttaccgt
ttcggcccgctgctgcaggacgttgacgcctggctgttgtccgaggggacgcacctgcgc
ccttacgaaactctgggcgcgcacgccgacaccatggatggcgtcaccggtacgcgcttt
tcggtctgggcgccaaacgcccgccgggtctcggtggtggggcaatttaactactgggat
ggccgacgccatccgatgcgcctgcgtaaagagtccggtatctgggaactcttcattccc
ggcgcgcttaatggccagctgtataaattcgagctgatcgatgctcatggcaatctacgg
gtcaaagccgatccttacgccttcgagtcgcagatgcgcccggaaagcgcgtcgcttatc
tgcgatttgccgcccaaagtcgagcagccggcggcgcgtaaagccgcgaaccagtttgat
gcgccgatctctatctatgaagtgcacctcgggtcctggcgccgccataccgacaataac
ttctggctaagctaccgcgaactggcggaccaactggtgccttacgcaaaatggatgggc
ttcacccatctggaactgctgccggtaaacgaacacccgttcgacggcagctggggctac
cagccgaccggcctctacgcgccgacacgccgcttcggtacccgtgaagatttccgctat
ttcatcgatgccgcccacgccgcgggccttaacgtgatcctcgattgggttccgggtcat
ttcccggcggatgactttgcgctggcctcatttgacggcacctcgctgtatgaacacagc
gatccgcgcgaaggttaccaccaggattggaatacgcttatctataactacggccgccgc
gaagtcagcaattacctggtaggtaacgcgctgtactggatcgagcgcttcggcattgac
gcgctgcgcgtcgacgcggtggcgtcgatgatctaccgcgactatagccgtaaagcgggc
gagtggatccccaacgaatacggcgggcgggaaaatctcgaagcgatcgagtttctgcgt
aacaccaaccgtattctcggcgagcagacgccaggcgcggtaacgatggcggaagagtcc
accgattttgccggcgtgacgcgtccgcccgccgatggcggcctcggcttctggttcaaa
tggaatctcggctggatgcacgacacgctggattatatgaaactcgatccagtccatcgt
cgctaccatcacgacaaaatgaccttcggcatgctctacaactacaccgagaacttcgtg
ctgccgctctcccacgatgaagtggtgcacggcaaaaaatcgattctcgaccgcatgccg
ggcgacgcatggcagcgctttgccaacctgcgcgcctattacggctggctgttcgccttc
ccgggcaaaaagctgctgtttatgggcaatgaattcgcccagggccgcgagtggaaccac
gacgccagtctcgactggcatctgctggagggtggcgacaactggcaccacggcgtccag
cggctggtgcgcgacctgaaccatacctaccgccaccataaagcgttgcatgaacttgat
ttcgatccctacggcttcgaatggctggtggtcgacgatcatgagcgttcggtatttatc
ttcgtgcgccgcgataaagccggtaatgaaatcatcgtcgccagcaacttcacgccggtg
ccgcggcacaactaccgtttcggcatcaaccagccgggacgctggcgcgaggagctgaat
accgactcgatgcattatcacggtagtaacgccggaaatggcggcgtggttgagagcgag
tccgtcgccagtcacggtcgtcagcattcgttgtcgattaccctgccgccgctggcgacc
atctggctggtacgggaggcctga

DBGET integrated database retrieval system