KEGG   Enterobacter aerogenes EA1509E: ST548_p4243Help
Entry
ST548_p4243       CDS       T02447                                 

Definition
Endoglucanase precursor (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ear  Enterobacter aerogenes EA1509E
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ear00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ST548_p4243
Enzymes [BR:ear01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     ST548_p4243
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4182949..4184055
Genome map
AA seq 368 aa AA seqDB search
MNAFRGVLLSVLMLAAGQVSAACQWPAWEQFKKAYVSAEGRVIDPSDARKITTSEGQSYA
LFFALAANDRQGFDKLFQWTQNNLAQGDLRAHLPGWLWGKKSEDEWTVLDSNSAADSDLW
IAWALLEAGRLWKVDNYTEVGKALLARIADEEVADVPGLGPSVLPGKVGFADDKGWRFNP
SYLPPQLATYFTRFGAPWPKIRDSNLRLLLETAPKGFSPDWVRYEKGSGWQLKTDKPIIG
SYDAIRVYLWVGMLNNADKQKAPLLARFKPMAVQTIKQGLPPEKTNIASGKTTGEGPVGF
SAAMLPFLQDDDARALQRQRVADHYPDADAYYSAVLTLFGQGWDQHRFRFAAGGELQPDW
NQACASSH
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcatttcgtggggtacttctctcggtattgatgctggcggcggggcaggttagc
gccgcctgccagtggcccgcctgggagcagtttaaaaaagcgtatgtcagcgccgaaggg
cgggtcatcgaccccagcgatgcgcgcaaaatcaccacctccgaagggcaaagctacgcg
ctgttcttcgctctcgcggccaacgatcgccagggcttcgataagctgttccagtggacg
cagaacaacctggcgcagggcgatctgcgcgcccatctgccgggatggctatgggggaaa
aagagcgaggatgaatggacggtgctggacagcaattcagctgcggattctgatttgtgg
attgcctgggcgctgctggaagccggacgcctgtggaaggttgataactatactgaggta
ggaaaagcgctgctggcgcggattgccgatgaagaagtcgctgatgttccggggctcggg
ccgtcggtactgccggggaaagttggtttcgcggacgacaagggctggcgctttaatcca
agttatctgccgccgcagctcgccacctactttacccgctttggcgcgccgtggccgaag
atccgcgacagcaatctgcgactgctgctggaaacggcgccaaaaggcttctcgccggac
tgggtgcgctatgagaaaggtagcggctggcagttgaaaaccgataaaccgattattggc
agctatgacgctatccgcgtctatctgtgggtcggaatgctcaataacgccgataaacaa
aaagcgccgctgttggcgcgtttcaaaccgatggcggttcagacgatcaaacagggatta
ccgccggaaaaaaccaatatcgccagcgggaaaacgactggcgaggggccggttggcttc
tccgcagccatgctgccgtttttacaagatgacgacgcccgcgcgctacaacgccaacgg
gtcgccgatcattatcccgacgcggacgcctactacagcgcggtgctgacgctgttcggc
caggggtgggatcaacatcgttttcgtttcgccgcgggtggcgaattacaacctgactgg
aaccaggcatgcgcaagttctcactaa

DBGET integrated database retrieval system