KEGG   Enterobacter aerogenes EA1509E: ST548_p4280Help
Entry
ST548_p4280       CDS       T02447                                 

Definition
Xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
ear  Enterobacter aerogenes EA1509E
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ear00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ST548_p4280
   00051 Fructose and mannose metabolism
    ST548_p4280
Enzymes [BR:ear01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     ST548_p4280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4138582..4139904
Genome map
AA seq 440 aa AA seqDB search
MQTYFDQLDRVRYEGPKSTNPLAFRHYNPDELVLGKRMEDHLRFAACYWHTFCWNGADMF
GVGSFDRPWQQPGEALEMAKRKAEVAFEFFHKLNVPYYCFHDVDVSPEGASLKEYSNNFA
QMVDVLVEKQQQSGVKLLWGTANCFTNPRYGAGAATNPDPEVFSWAATQVVTAMNATHKL
GGENYVLWGGREGYETLLNTDLRQEREQIGRFMQLVVEHKHKIGFQGTLLIEPKPQEPTK
HQYDYDASTVYGFLKQFGLEKEIKLNIEANHATLAGHSFHHEIATAIALGLFGSVDANRG
DAQLGWDTDQFPNSVEENALVMYEILKAGGFTTGGLNFDAKVRRQSTDKYDLFYGHIGAM
DTMALSLKVAARMIEDGELDKRVAKRYAGWNGELGQQILTGQMTLTDIAHYATQHNLAPQ
HHSGHQELLENLVNHYLFDK
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgcagacctatttcgatcaactcgatcgcgttcgttatgaaggcccgaaatcgactaac
ccactggctttccgtcactacaatccggatgaattagtactgggtaaacgcatggaagac
cacctgcgtttcgctgcctgctactggcacactttctgctggaatggcgcggatatgttt
ggcgtggggtccttcgatcgtccatggcagcagccgggcgaagcgctggaaatggcgaaa
cgtaaagccgaagtggcatttgagtttttccataagttgaatgtgccgtattactgcttc
catgatgtcgacgtttctccggaaggcgcttcgctgaaagagtacagcaacaacttcgcg
cagatggtggacgtactggtggaaaaacagcagcagagcggcgttaaactgctgtggggg
acggcaaactgctttaccaacccgcgttatggcgcaggggcggcgacaaaccccgatccg
gaagtctttagttgggcggcgactcaggtagtcaccgcaatgaatgcgacccacaagttg
ggcggtgaaaactacgttctgtggggcggtcgcgaaggctacgaaaccctgcttaatacc
gatctgcgccaggagcgcgagcagattggccgctttatgcaactggtggttgaacacaaa
cacaaaattggtttccagggcaccctgctgatcgagccgaagccgcaggagccgaccaag
caccaatatgattatgatgcctccacggtttacgggttcctgaaacagtttggtctggaa
aaagagattaaactgaacattgaagccaaccacgccacccttgccggccactctttccac
cacgagatcgccacggctattgcgctgggcctgttcggttcggtggacgcgaaccgcggc
gatgcgcagctgggctgggataccgaccagttcccgaacagcgtggaagagaacgccctg
gtgatgtatgagatcctcaaggcgggcggcttcaccaccggcggcctgaactttgatgct
aaagttcgtcgccagagcaccgacaaatacgatctgttctacggccatatcggcgcgatg
gacactatggcgctgtcgctgaaagttgcggcgcgcatgattgaagacggcgagctggat
aaacgcgtggcgaaacgctacgccggctggaacggcgaattgggccagcagatcctcaca
ggccagatgaccctgaccgacatcgcgcactatgcgactcagcataacctggcgccgcag
caccacagcgggcatcaagagttgttggaaaacctggtaaaccattatctgttcgataag
taa

  All links  
No link information was found.   
DBGET integrated database retrieval system