KEGG   Enterobacter aerogenes EA1509E: ST548_p4331Help
Entry
ST548_p4331       CDS       T02447                                 

Definition
Formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
ear  Enterobacter aerogenes EA1509E
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:ear03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4084069..4084878
Genome map
AA seq 269 aa AA seqDB search
MPELPEVETSRRGIEPHLVGANILHAVVRNGRLRWPVSEEIYRLSDEPVLSVRRRAKYLL
LELRHGWIIIHLGMSGSLRILSEEQPAEKHDHVDLVLSNGKVLRYTDPRRFGAWLWTKEL
DGHPVLAHLGPEPLSDEFNADYLQQRCAKKKTAIKPWLMDNKLVVGVGNIYASESLFSAG
IHPDRLASSLSHQECEWLVKMIKLVLLRSIEQGGTTLKDFLQSDGKPGYFAQELQVYGRK
GEPCRICGTPIIASKHAQRATFYCRQCQK
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaattacccgaagtcgaaaccagccgtcgcggcattgagccgcatctggtgggc
gctaacatcctgcatgccgtagtgcgcaacgggcgcctgcgttggccagtatccgaagag
atttaccgcctcagcgacgaaccggtgctgagcgtgcgccgacgcgccaaatacctgctg
ctggagctgcgtcacggctggatcattattcatcttggcatgtccggcagcctgcgcatc
ctcagtgaagagcagccggctgaaaaacacgaccacgtcgacctggtgctgagtaacggt
aaagtgctgcgctataccgatcctcgccgctttggcgcctggttatggactaaagagctg
gatggtcatccggtgctggcgcatctcggcccggagccgctaagcgatgaattcaacgcc
gactatctccagcagcgttgcgcgaagaagaaaaccgccattaaaccctggctgatggat
aacaagctggtggtgggcgtggggaatatctacgccagcgaatcgctgttttccgccggg
atccatcccgatcggctggcctcgtcgctctcgcatcaggaatgcgagtggttagtgaag
atgattaagctggtgctgctacgctcaattgagcagggtggaacgacgctgaaggatttc
ctgcaaagcgacggcaaaccgggatatttcgcccaggagctgcaggtatatggccgcaaa
ggcgagccgtgccggatctgcggcacgccgattatcgccagcaaacacgctcagcgcgcg
accttttattgtcgccagtgtcagaagtag

DBGET integrated database retrieval system