KEGG   Enterobacter aerogenes EA1509E: ST548_p4631Help
Entry
ST548_p4631       CDS       T02447                                 

Definition
Uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ear  Enterobacter aerogenes EA1509E
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:ear00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3767506..3768246
Genome map
AA seq 246 aa AA seqDB search
MSILVTRPLPQGEELVSRLRALGRVAWSFPLIEFTPGRELAALPRQLAALGADDLLFALS
QHAVEFAHARLLQESQRWPSDPAYFSIGRTTALALHTVSGKNIRYPLDREISEVLLQLPE
LQNIAGKKALILRGNGGRELLGDTLRDRGAEVTFCECYQRCAKYYDGAEEAMRWQSRGVT
TLVVTSGEMLQQLWSLIPQWYREQWLLHCSLIVVSERLALQARELGWQDIQVADNADNDA
LLRALQ
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcctggtcacccgtccgctaccgcaaggtgaagagttagtcagccgcctgcgc
gcgctgggacgcgtggcctggagctttccgctgattgaattcacgccggggagagagctg
gcagcgctcccgcgtcaactggcggcattaggcgcggacgatttgttgtttgcgctgtcg
cagcatgcggtggaattcgcccatgcccgtctactgcaggagagccaacgctggccctcc
gacccggcctatttctcgataggccgcaccaccgcgctggctctgcatacggtcagtggt
aaaaatatccgttacccgttagatcgggaaatcagcgaagtcttgctacaattacctgaa
ttacaaaacattgcgggcaagaaagccctgattctgcgcggcaacggcggccgggaatta
ctcggcgacacgctgcgagatcgcggcgccgaagtaacattttgtgaatgttatcaacgt
tgtgcgaagtactatgatggtgcggaagaggctatgcgctggcaatctcgtggagtcaca
acgctggtggtcaccagcggcgagatgctgcagcagctgtggtcgttaataccccagtgg
tatcgcgaacagtggctgctgcactgtagccttatcgttgtcagcgaacgtctggccctt
caggcccgggaattgggctggcaggatattcaggttgccgataacgccgacaacgatgcg
ctgctacgcgcattacaataa

DBGET integrated database retrieval system