KEGG   Enterobacter aerogenes EA1509E: ST548_p4712Help
Entry
ST548_p4712       CDS       T02447                                 

Definition
Isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
ear  Enterobacter aerogenes EA1509E
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:ear01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:ear00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3668051..3669355)
Genome map
AA seq 434 aa AA seqDB search
MKTRTQQIEELNKEWTNPRWEGITRPYSAEEVVKLRGSVNPECTLAQLGAAKMWRLLHGE
AKKGYINSLGALTGGQALQQAKAGIEAIYLSGWQVAADANLASSMYPDQSLYPANSVPSV
VDRINNTFRRADQIQWAAGIEPNDPRFIDYFLPIVADAEAGFGGVLNAFELMKSMIAAGA
AAVHFEDQLASVKKCGHMGGKVLVPTQEAIQKLVAARLAADVMGVPTLLIARTDADAADL
ITSDCDPYDREFISGDRTSEGFYRTHAGIEQAISRGLAYAPYADLVWCETSKPDIEQARR
FAEAIHARFPGKLLAYNCSPSFNWKKNLDDKTIASFQQQLSDMGYKFQFITLAGIHSMWF
NMFDLAHAYAQGEGMRHYVEKVQQPEFAAGPEGYTFVSHQQEVGTGYFDKVTTIIQGGTS
SVTALTGSTEESQF
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacccgtacccaacaaatcgaagaattaaacaaagagtggacgaacccgcgctgg
gaaggcattacccgcccatacagcgcggaagaggtggtgaagttacgcggctcggtgaac
ccggagtgcacgctggcgcagcttggcgcggcgaaaatgtggcgtctgctgcatggtgaa
gcgaaaaagggttatatcaacagccttggcgcgttaaccggcggccaggcgctgcagcag
gcgaaggcgggcattgaagccatctacttgtctggctggcaggtcgccgccgacgccaac
ctggcctccagtatgtacccggatcaatcgttgtacccggctaactcggtgccatcggtg
gttgatcggatcaataacaccttccgtcgcgccgatcagatccagtgggcggcggggatt
gagccgaacgatccgcgttttatcgactatttcctgccgatcgtcgccgatgcggaagcc
ggttttggcggcgtgctgaacgcctttgagctgatgaaatcgatgattgcggccggtgca
gcggccgtgcatttcgaagatcagctggcgtcggtgaagaagtgcggacatatgggcggc
aaggtgctggtgccgacacaagaggcgattcagaagctggtcgccgcgcgcctggcggcg
gatgtgatgggcgtgccgacgctgcttatcgcccgtaccgacgccgatgccgctgacctg
attacctcggattgcgatccttacgatcgcgagtttatctccggcgatcgcaccagcgaa
ggtttttatcgcacccatgccggaatcgaacaggcaatcagccgcggcctggcctacgcc
ccttacgctgacctggtatggtgtgaaacctccaaaccggacattgaacaggcgcgtcgt
tttgccgaggcgattcacgcccgcttcccgggcaagctgctggcctataactgctcgcca
tcttttaactggaagaaaaatctcgacgataaaaccatcgccagcttccagcagcagctg
tcggatatgggctataaattccagttcattaccctggcgggtattcacagcatgtggttc
aacatgttcgacctggcccacgcctacgcgcagggtgaaggcatgcgtcactacgtcgaa
aaagttcagcagccggagtttgctgccgggccggaaggctacaccttcgtgtcgcatcag
caggaggtgggtaccgggtacttcgataaagtgaccaccattatccagggggggacctcg
tcggtaacggcgctgaccggctcgaccgaagaatcgcagttttaa

DBGET integrated database retrieval system