KEGG   Enterobacter aerogenes EA1509E: ST548_p5184Help
Entry
ST548_p5184       CDS       T02447                                 

Definition
Thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
ear  Enterobacter aerogenes EA1509E
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ear00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    ST548_p5184
Enzymes [BR:ear01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     ST548_p5184
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3189978..3191300)
Genome map
AA seq 440 aa AA seqDB search
MFLAQEIIRKKRDGHVLSDEEIRFFINGIRDNTISEGQIAALAMTIFFHDMSMPERVSLT
MAMRDSGTVLDWKSLNLNGPIVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHT
GGTLDKLEAIPGFDIFPDDARFREIIKDVGVAIIGQTSSLAPADKRFYATRDITATVDSI
PLITASILAKKLAEGLDALVMDVKVGSGAFMPTYELSEALAEAIVGVSNGAGVRTTALLT
DMNQVLASSAGNAVEVREAVQFLTGEYRNPRLYDVTMALCVEMLISGKLAADDAEARAKL
QAVLDNGKAAEVFGRMVAAQKGPSDFVENYAKYLPTAMLSKAVYAEGAGFVSEMDTRALG
MAVVSMGGGRRQASDTIDYSVGFTDMARLGDKVDGERPLAVIHAKDESSWQEAAKAVKAA
IKLDAHAPEITPTVYRRITK
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
gtgtttctcgcacaagaaattattcgtaaaaaacgtgatggtcatgtattaagcgatgaa
gaaattcgctttttcatcaacggtatccgcgataatactatctctgaaggacagatcgcc
gcgctggcgatgaccatcttcttccatgatatgtctatgccggaacgtgtctcgctgacc
atggcgatgcgggattcaggaaccgttctcgactggaaaagccttaacctcaacggcccg
atcgtcgataaacactcgaccggcggcgtgggtgacgtcacctcgctgatgctggggcca
atggttgccgcctgcggcggttacgtaccgatgatctccgggcgtggtctcggccatacc
ggcggtacgcttgataaactggaagcgatcccgggttttgatattttcccggacgacgcg
cgtttccgcgaaattattaaagatgtcggcgtggcgattatcgggcagaccagctcgctc
gcgccggctgacaaacgtttctatgccacccgcgatattaccgcgacggtggattccatc
ccgctgattaccgcgtctattctggccaagaaactggcggaaggtctggacgcgctggtg
atggacgttaaagtcggcagcggcgcctttatgccgacttatgagctttcagaagcgctt
gccgaagcgatcgttggcgtctctaacggcgccggcgtgcgcacgaccgcactgttaacg
gatatgaaccaggtgctggcctccagcgcgggtaacgccgttgaagttcgcgaagcggta
cagttcctgaccggcgaataccgcaacccgcgcctgtacgacgtcaccatggcgctgtgc
gtggaaatgctgatttccggcaagctggcggcggatgacgccgaggcgcgcgcgaaattg
caggcggtgctggataacggtaaagcggcggaagtctttggccgcatggtggcggcgcag
aaggggccgagcgactttgtcgaaaactatgcgaaatacctgccgacggcaatgctgagc
aaagcggtctatgctgaaggcgccggatttgtctctgaaatggatacccgcgcgctgggg
atggcggtggtgtcgatgggcggcggtcgtcgccaggcttccgatactattgactacagc
gttggctttaccgatatggcgcgccttggcgataaagttgatggcgaacgtccgctggcg
gtgattcatgcgaaagatgaatcgagctggcaggaagcggccaaagccgtgaaagcggca
ataaaattggacgcccacgccccagaaattacaccgacggtctatcgccgtatcaccaag
tag

DBGET integrated database retrieval system