KEGG   Enterobacter aerogenes EA1509E: ST548_p5207Help
Entry
ST548_p5207       CDS       T02447                                 

Definition
(RefSeq) Threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ear  Enterobacter aerogenes EA1509E
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ear00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ST548_p5207
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ST548_p5207
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    ST548_p5207
Enzymes [BR:ear01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     ST548_p5207
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3164443..3165723)
Genome map
AA seq 426 aa AA seqDB search
MKLYNLKDHNEQVSFAQAVTQGLGKQQGLFFPHDLPEFNLTEIDEMLEQDFVTRSAKILS
AFIGDEIPQNELQARVASAFAFPAPVTQVQDDVGCLELFHGPTLAFKDFGGRFMAQMLTH
IAGDKPVTILTATSGDTGAAVAHAFYGLPNVKVVILYPRGKISPLQEKLFCTLGGNIETV
AIDGDFDACQALVKQAFDDEELKVALGLNSANSINISRLLAQICYYFEAVAQLPQEARNQ
LVVSVPSGNFGDLTAGLLAKSLGLPIKRFIAATNANDTVPRFLQDGNWAPKATQATLSNA
MDVSQPNNWPRVEELFRRKIWRLNELGYAAVDDETTKATMRELKSIGYTSEPHAAIAYRA
LRDQLQPGEYGLFLGTAHPAKFKESVEEILQETLPLPKELADRADLPLLSHNLPADFAAL
RKLMMG
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtataacttaaaagatcataacgaacaggtcagctttgcgcaggccgtgacg
caagggcttggcaaacaacaggggctgttctttccgcacgatttgccggaattcaatctg
accgaaatcgacgaaatgctggagcaggatttcgtgacccgtagcgcgaaaatcctgtcg
gcctttattggcgatgagatcccgcagaatgaactgcaggcccgcgtggcttcggcgttc
gccttcccggcgccggtcactcaagtacaggatgatgtcggctgcctggagctgttccac
ggcccgaccctggcgtttaaagattttggcggccgttttatggcccagatgctgacgcat
atcgcaggcgataagccggtgacgatcctgaccgcgacctccggcgacaccggcgcggcc
gtagcgcatgccttctacggcctgccgaacgtcaaggtagttatcctctatccgcgcggt
aagattagcccgctgcaggagaagctgttctgcaccctgggcggcaacatcgaaaccgtg
gcgattgacggtgatttcgacgcctgtcaggcgctggttaagcaggcgtttgacgatgaa
gaactgaaggtcgcgcttggtctcaactccgccaactctattaatatcagtcgtctgctg
gcgcagatctgctactacttcgaggcggtcgcgcagttgccgcaggaggcccgtaaccag
ctggtggtgtcggtgccaagcggcaacttcggcgatctcaccgccggcctgctggcgaaa
tcgctggggctgccgattaagcgttttattgccgctaccaacgccaacgataccgtgccg
cgcttcctgcaggatggcaactgggcgccgaaggcgacgcaggcgaccctgtctaacgcc
atggacgtcagccaaccgaacaactggccgcgcgtggaagaactgttccgccgcaaaatc
tggcgtcttaatgagctgggatacgccgcggttgatgatgaaaccaccaaagcaaccatg
cgtgaactgaagtccatcggctacacctctgaaccgcatgcggcgattgcttatcgcgcg
ctgcgcgaccaattgcaaccgggcgagtacgggttattcctcggtaccgcgcatccggcg
aaattcaaagagagcgtagaagagattctgcaggagacgctgccgctgccgaaagaactg
gccgatcgcgccgacctgccgctgctgtcgcataatctgccggctgatttcgccgcgctg
cgtaagctgatgatgggctaa

DBGET integrated database retrieval system