KEGG   Enterobacter aerogenes EA1509E: ST548_p5969Help
Entry
ST548_p5969       CDS       T02447                                 

Definition
Pectinesterase (EC:3.1.1.11)
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
ear  Enterobacter aerogenes EA1509E
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ear00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ST548_p5969
   00500 Starch and sucrose metabolism
    ST548_p5969
Enzymes [BR:ear01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     ST548_p5969
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2368637..2369920
Genome map
AA seq 427 aa AA seqDB search
MNTYSVSRLALALAFGVTLSACSSTPADQKPSTQTAPGNTARPILSADEAKNFTQAAYFQ
SLTPNAAAWTPSAISLPAQPDFIVGPAGAQGVTHTTIQAAVDAAIARHSARRLFIAVMPG
EYAGTVYVPAAPGALTIYGTGENPADVKISEAIDSEMDRNSWRHLVNPGGKYMPGKPAWY
MFDSCQSKSAATVGVMCSAVFWSQNNGLQLQNLTIANNLGDSVDAGTHQAVALRSDGDQV
QINKVNILGRQNTFFVTNSGVQNRLQDNRQTRTLVTNSYIEGDVDIVSGRGAVVFDNTDF
RVVNSRTQKEAYVFAPATLKSVTYGFLATNSRFTASGDNVAQLGRALDVDGNSNGQVVIR
DSVINEGFNIAQPWAAAVGSNRAFSGNVGAQYDKGNPQRNLNDNGFNRMWEYNNRGVGSF
VVAAPKQ
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaacacatattccgtttcccgtctggcgctggcgctggccttcggcgtgacgctgtcc
gcctgtagctcgacgcctgccgatcaaaagccctcaacgcagactgcaccgggcaatacc
gcacggccgattcttagcgccgatgaagcgaaaaacttcactcaagcggcctattttcag
tcgctgacgccgaatgccgccgcgtggacgccatccgctatcagcctgccggcgcagcct
gatttcatcgtcggcccggcgggtgcccagggcgtgacccacacgactattcaggccgcg
gtcgatgcggcgattgcccgtcactctgcccgtcgcctgttcatcgctgttatgccaggc
gaatatgcgggtactgtctacgtgcctgccgcgccgggcgcgctgacgatttatggtacc
ggtgaaaaccctgccgacgtcaaaatcagcgaagcgattgattccgaaatggaccgcaat
agctggcgtcatctggtcaatccgggcggcaaatacatgccaggcaagcccgcgtggtat
atgttcgacagctgccagagcaaatccgccgccaccgtcggcgtgatgtgttccgcggtc
ttctggtcgcagaataatggcctgcagctgcagaacctgaccatcgccaacaatctcggc
gacagcgtcgatgccggtacccatcaggcagtggccttgcgcagcgatggcgaccaggtg
cagatcaacaaggtcaacattcttggccgccagaacaccttctttgtgaccaatagcggc
gtgcagaaccgtctgcaggataaccgtcagacccgtacgctggtaactaatagctatatt
gaaggcgatgtggatatcgtttccggtcgcggcgcggtggtattcgataataccgatttc
cgcgtcgtgaactcgcgtacgcagaaagaagcctacgttttcgccccggcaacgctgaaa
agcgtaacctacggcttcctggcgaccaatagccgcttcaccgcgtccggcgataacgtc
gcgcagctgggccgcgcgctggacgtcgacggcaacagcaatggccaggtggtgattcgc
gatagcgtcatcaatgaaggcttcaacattgctcaaccgtgggcggcggcggtcggttct
aatcgcgccttcagcggtaatgttggcgcgcagtatgacaaaggcaacccgcagcgtaac
cttaacgacaacggcttcaaccgcatgtgggaatataacaaccgcggcgtaggcagtttt
gtggttgccgctccgaaacagtaa

DBGET integrated database retrieval system