KEGG   Enterobacter aerogenes EA1509E: ST548_p6260Help
Entry
ST548_p6260       CDS       T02447                                 

Definition
Chemotaxis response regulator protein-glutamate methylesterase CheB (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
ear  Enterobacter aerogenes EA1509E
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:ear00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ST548_p6260
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    ST548_p6260
Enzymes [BR:ear01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     ST548_p6260
Two-component system [BR:ear02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   ST548_p6260
Bacterial motility proteins [BR:ear02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    ST548_p6260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2047466..2048515)
Genome map
AA seq 349 aa AA seqDB search
MSKIRVLCVDDSALMRQLMTEIVNGHADMEMVAVAPDPLVARDLIKKFNPQVLTLDVEMP
RMDGLDFLEKLMRLRPMPVVMVSSLTGKGSEITLRALELGAVDFVTKPQLGIREGMLAYS
ELIGEKIRTAARARLPQRANDQPPAILSHGPLLSSEKLIAIGASTGGTEAIRQVLQPLPA
TSPALLITQHMPPGFTRSFAERLNKLCQITVKEAEEGERVLPGHAYIAPGDRHLELARSG
ANYQVKLHDGPAVNRHRPSVDVLFRSVARHAGRNAVGVILTGMGNDGAQGMLEMHRAGAY
TLAQSEASCVVFGMPREAIASGGVNEVVELERMSQRMLAQIAGGQALRI
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaatcagagtgttatgtgttgatgattcggccctgatgcgccagttgatgacc
gagatcgtcaatggccacgccgatatggagatggtggcggtggccccggacccgctggtc
gcacgggatctgatcaaaaaatttaacccacaggtgctgacgctggacgtcgaaatgccg
cgcatggacggcctcgatttcctcgaaaagctgatgcgcctgcggccgatgccggtggtg
atggtttcatcgctgaccggtaaaggttcggaaattaccctgcgcgcgctggagctgggg
gcggtggatttcgtcaccaaaccgcagctagggatccgcgaaggcatgctggcctacagc
gaactgataggcgaaaagatccgtaccgccgcacgggcgcggctgccgcagcgggccaat
gaccagccgccggccattttaagccacggaccgctgctgagcagcgagaagctgatcgcc
attggcgcttccaccggcggcaccgaagcgattcgtcaggtgctacaaccgttgccggcc
accagtccggctctgcttatcacccagcatatgccgccgggatttacccgctcgtttgcc
gaacggttgaataagctgtgccagatcacggtgaaagaggcggaagagggcgaacgcgtg
ctccctggacacgcctatattgcgcctggggatcgccatctggagctggcgcgtagtggc
gctaactatcaggtcaagttgcacgacggcccggcggtaaatcgccatcgtccctcggtg
gatgtgctgtttcgttcggtggcccgccacgccgggcgcaatgcggtgggggtgatcctc
accggcatgggcaacgacggcgcgcaggggatgctggagatgcatcgcgccggggcctat
accctggcgcagagtgaggcgagctgcgtggtgttcggcatgccgcgcgaggccatcgcc
agcggtggggtcaacgaagtggttgaactggagcgcatgagccaacgcatgctggcgcag
atcgccggcggccaggcgctgcgaatttaa

DBGET integrated database retrieval system