KEGG   Enterobacter aerogenes EA1509E: ST548_p6490Help
Entry
ST548_p6490       CDS       T02447                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
ear  Enterobacter aerogenes EA1509E
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:ear00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1817878..1818729
Genome map
AA seq 283 aa AA seqDB search
MSRWPAPAKLNLFLYITGQRADGYHTLQTLFQFLDYGDTLTIEPRRDGKLRLLTPVAGVP
DEENLIIRAARLLMAAAESHGQLPAGSGADISIDKRLPMGGGLGGGSSNAATVLVALNHL
WGCGLSEDQLATLGLQLGADVPVFVRGHAAFAEGVGEILTPVDPPEKWYLVAHPGVSIPT
PIIFRDPELPRNTPSRSINTLLNCEFGNDCEVIARKRFREVDATLSWLLEYAPSRLTGTG
ACVFAEFDTESAARQVLEKAPEWLQGFVARGINVSPLKQALLK
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgctggcccgcccccgcaaaattgaatctgtttttgtatatcaccggtcaacgc
gccgatggttatcacacgctgcagacgttgtttcagtttctcgactatggcgacacgctg
accattgaaccgcgccgcgacgggaaactgcggttgttaacgccggtcgccggcgtgccg
gatgaagagaacctgattatccgcgccgccaggctactgatggcggcggcggagtctcac
ggtcaactccccgcaggcagcggcgcggatatcagcatcgacaaacgcctgccgatgggc
ggcggcttaggcggcggctcttctaacgccgcgacggtgctggtagccctcaatcatctg
tggggctgcgggcttagcgaagaccagctggcgacgcttgggctacagctcggcgccgat
gtcccggttttcgttcgcggtcacgcggcgtttgccgaaggggttggcgagattctcacc
ccggtcgatccgccggaaaaatggtatctggtcgcccacccgggcgtaagtatcccgacg
ccgatcatttttcgcgatccggagttaccacgaaataccccgagcaggtcaattaatacc
ttactaaactgtgaattcggcaacgattgcgaggttatcgcaagaaaacgttttcgtgag
gttgatgcaacgctttcctggctgttagaatacgcgccgtcgcgcctgactggcacagga
gcctgtgtgtttgctgaatttgacaccgaatccgccgctcgtcaggtgctggaaaaagcc
ccggaatggctgcaaggctttgttgcgcgaggaataaatgtctcgccgctgaagcaagcc
ctactgaagtaa

DBGET integrated database retrieval system