KEGG   Enterobacter aerogenes EA1509E: ST548_p6530Help
Entry
ST548_p6530       CDS       T02447                                 

Definition
Alcohol dehydrogenase ; Acetaldehyde dehydrogenase (EC:1.2.1.10 1.1.1.1)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
ear  Enterobacter aerogenes EA1509E
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ear00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    ST548_p6530
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ST548_p6530
   00620 Pyruvate metabolism
    ST548_p6530
   00650 Butanoate metabolism
    ST548_p6530
  Lipid metabolism
   00071 Fatty acid degradation
    ST548_p6530
  Amino acid metabolism
   00350 Tyrosine metabolism
    ST548_p6530
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ST548_p6530
   00626 Naphthalene degradation
    ST548_p6530
Enzymes [BR:ear01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     ST548_p6530
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     ST548_p6530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1772745..1775423
Genome map
AA seq 892 aa AA seqDB search
MAVTNVAELNALVEHVKKAQREYASFTQEQVDKIFRAAALAAADARIPLAKMAVAESGMG
IIEDKVIKNHFASEYIYNAYKDEKTCGVLSEDDTFGTITIAEPIGIICGIVPTTNPTSTA
IFKSLISLKTRNAIIFSPHPRAKDATNKAADIVLQAAIAAGAPKDLIGWIDQPSVELSNA
LMHHPDINLILATGGPGMVKAAYSSGKPAIGVGAGNTPVVIDETADIKRAVASVLMSKTF
DNGVICASEQSVVVVDSVYDAVRERFASHGGYLLQGKELKAVQDIILKNGALNAAIVGQP
AAKIAELAGFTVPATTKILIGEVTDVDESEPFAHEKLSPTLAMYRAKDFEDAVNKAEKLV
AMGGIGHTSCLYTDQDNQPARVAYFGQMMKTARILINTPASQGGIGDLYNFKLAPSLTLG
CGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGSLPIALDEVITDGHK
RALIVTDRFLFNNGYADQITSVLKAAGVETEVFFEVEADPTLTIVRKGADLANSFKPDVI
IALGGGSPMDAAKIMWVMYEHPETHFEELALRFMDIRKRIYKFPKMGVKAKMVAITTTSG
TGSEVTPFAVVTDDATGQKYPLADYALTPDMAIVDANLVMDMPKSLCAFGGLDAVTHALE
AYVSVLASEFSDGQALQALKLLKEYLPASYHEGSKNPVARERVHSAATIAGIAFANAFLG
VCHSMAHKLGSQFHIPHGLANALLISNVIRYNANDNPTKQTAFSQYDRPQARRRYAEIAD
HLGLSAPGDRTAAKIEKLLAWLESLKAELGIPKSIREAGVQEADFLAHVDKLSEDAFDDQ
CTGANPRYPLIAELKQILLDTYYGRDFVEGEAAAVKKEAAPAKAEKKAKKSA
NT seq 2679 nt NT seq  +upstreamnt  +downstreamnt
atggctgttactaatgtcgctgaacttaacgcacttgtagagcacgtaaaaaaagcccag
cgtgaatatgccagtttcactcaagaacaagttgataagatcttccgtgctgccgctctg
gccgctgcagatgctcgaatccctctcgctaaaatggctgttgccgaatccggcatgggt
attattgaagataaagtgatcaaaaaccacttcgcttccgaatatatctacaacgcctat
aaagatgaaaagacctgtggcgtcctgtctgaagacgacactttcggtaccatcaccatt
gctgagccaatcggtattatttgcggtatcgtcccgactaccaacccgacttctactgct
atcttcaaatcgctgatcagcctgaagacgcgtaacgccatcatcttctctccgcaccca
cgtgctaaagacgcgactaacaaagcggcggacatcgtattgcaggcagcgattgccgca
ggcgcgccgaaagatctgatcggttggatcgaccagccttccgtagaactgtctaacgca
ctgatgcatcatcctgacatcaacctgatcctcgccaccggcggcccaggtatggttaag
gccgcttatagctccggtaaaccagctatcggcgttggcgcgggcaacacgccggttgtt
attgatgaaacggctgatatcaaacgcgctgtggcgtccgtactgatgtcgaaaaccttc
gataacggcgttatctgtgcttctgaacaatccgtggtggttgtcgactccgtctacgac
gccgtccgcgagcgttttgccagccacggcggctacctgctgcagggtaaagagttgaaa
gccgttcaggacatcatcctgaaaaatggcgcgctgaatgcggcgatcgttggtcaacca
gcggcaaaaatcgctgaactggcaggcttcaccgtgccagccaccactaagattctgatc
ggcgaagttaccgacgttgacgaaagcgaaccgttcgctcacgaaaaactgtctccgacg
ctggcaatgtaccgggcgaaagatttcgaagacgcggtcaataaagcagaaaaactggtc
gccatgggcggtatcggtcacacctcttgcctgtacaccgaccaggacaaccagccggct
cgcgtggcctacttcggccagatgatgaaaaccgcgcgtatcctgatcaacaccccggcc
tcccagggtggtatcggcgacctgtataacttcaaactcgcaccttccctgactctgggt
tgtggttcctggggtggtaactccatctctgaaaacgttggtccgaaacacctgatcaac
aagaaaaccgttgctaagcgagctgaaaacatgttgtggcataaacttccgaaatctatc
tacttccgtcgtggctcactgccaatcgcactggatgaagtgattactgatggtcacaaa
cgcgcgctgattgtgactgaccgcttcctgttcaacaacggttacgcggaccagatcact
tccgtactgaaagcggctggcgtagaaaccgaagtgttctttgaagttgaagctgaccca
acgctgactatcgtgcgtaaaggcgcggatctggccaactccttcaaaccagacgtaatc
atcgccctgggcggcggttccccgatggatgcggcaaaaatcatgtgggtcatgtacgag
cacccggaaacccacttcgaagaactggcgctgcgctttatggatatccgtaaacgtatc
tacaagttcccgaaaatgggcgtcaaagccaagatggttgccattaccaccacctccggt
accggttctgaagttaccccgttcgccgtggtaaccgacgatgcaactggacagaaatat
ccgctggccgactacgctctgactccggatatggcgattgtcgatgccaacctggtcatg
gatatgccgaagtctctctgtgccttcggtggtctggatgccgtgactcacgctctggaa
gcttacgtctccgtactggcttctgagttctccgatggtcaggctctgcaggcgctgaaa
ctgctgaaagagtatctgccggcctcttaccatgaaggttctaagaacccggtagcccgt
gaacgtgtgcacagcgccgccactatcgccggtatcgcgtttgctaacgccttcctcggc
gtgtgccactcaatggcgcacaaactgggctcgcagttccacattcctcacggtctggca
aacgccctgctgatcagcaacgttatccgctataacgcgaatgacaacccgaccaagcag
accgcattcagccagtatgaccgtccgcaggcgcgccgtcgctacgctgagatcgcagac
cacctgggtctgagcgctccgggcgaccgcactgcggcgaaaatcgagaaactgctggca
tggctggaaagcctcaaagctgaactgggtattccgaaatctattcgcgaagccggcgtt
caggaagctgatttcctggctcacgtcgataagctgtctgaagacgccttcgatgaccag
tgcaccggcgctaacccgcgctacccgctgatcgccgagctgaaacagattctgctggat
acctactacggtcgtgactttgtagaaggtgaagcggcggctgtgaaaaaagaagcggct
ccggccaaagctgagaaaaaagcgaaaaaatccgcttaa

DBGET integrated database retrieval system