KEGG   Enterobacter aerogenes EA1509E: ST548_p7098Help
Entry
ST548_p7098       CDS       T02447                                 

Definition
Arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
ear  Enterobacter aerogenes EA1509E
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ear01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ear00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1215041..1215913)
Genome map
AA seq 290 aa AA seqDB search
MMPNTQSSLRLLFPQWQGGNNPPYFFGSRMLSWLAPPAQGVVEEVCVPEPGHAQLANEDG
IVGRRAIVEQLLDAQDKITRNQPETIVTLGGDCLVSLAPFAWLVEKYGDKLGVLWIDSHP
DVMTPEQFPHAHAHVLGALMGNGDAELTQVVRKPLSPGKALIAGIHSPLDVEKQFISERG
IATLSPSELRQNPQAIDEWIARERIEYLAIHLDLDVLDPALFRAVLFARPGRGVHDFGDV
AEGKLTIAEVVNLINQAAAQAKPVGLTVAEHLPWDTLNLKNMLEALPLLS
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgatgccaaatacccaatccagtctgcgtttgctttttccgcaatggcaaggcggcaac
aatccgccctacttcttcggctcccggatgctgtcctggctggcgccgcctgcgcaaggc
gttgtcgaggaggtctgtgtccccgaaccaggacacgctcaactggcaaatgaagatgga
attgtcggccgccgggcgatcgttgaacagttgcttgatgcacaagacaaaatcactcga
aatcagccagagaccattgtcaccttagggggcgattgcctggtctccctggctcctttc
gcctggcttgtggaaaaatatggcgataaattgggggtattatggattgattctcacccg
gacgttatgacgccagagcagttcccacatgcccatgcccacgttcttggggctttaatg
ggcaatggcgacgcggaattaacccaggtggtcagaaagccattatcacctggcaaagcg
ctcattgccgggatccatagcccgctcgatgtcgaaaaacagtttattagtgaacgcggc
atcgccaccttaagcccatcagagctgcgtcagaatccgcaggcgattgacgagtggata
gcgcgtgaacgtattgagtacctggccatccatctcgatcttgatgtcctcgacccggcc
ctgtttcgagcagtgctatttgctcgtccggggcgcggcgtacacgattttggcgatgtc
gccgaagggaaactgacgattgccgaagtggttaatcttatcaatcaagccgccgctcag
gccaaaccggtcggcctcaccgtcgccgaacacctgccctgggataccttaaacctgaag
aatatgctcgaagctctaccattattgagttaa

DBGET integrated database retrieval system