KEGG   Enterobacter aerogenes EA1509E: ST548_p7665Help
Entry
ST548_p7665       CDS       T02447                                 

Definition
Phage lysin (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
ear  Enterobacter aerogenes EA1509E
Brite
Enzymes [BR:ear01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     ST548_p7665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
641537..642073
Genome map
AA seq 178 aa AA seqDB search
MSNKVKFSAAMLALLAAGASAPVLFDQFISEKEGNALVAVVDPGGVWSLCHGVTVIDGRR
VIKGQRATEAQCKKVNAIERDKALAWVEKNVHVPLTPPQKVGIASFCPYNIGPGKCFPST
FYRKLNAGDRKGACAEIRRWVFDGGRDCRLTKGQKNGCYGQVDRREQESALTCWGLYE
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacaaagttaagttcagcgccgcgatgctggcactgctggccgccggtgcatct
gcgccggtgctgttcgatcagtttatcagcgaaaaagaaggtaacgcgctggtggccgtt
gttgacccgggcggtgtgtggtcgttgtgccacggagtaaccgttatagatggcaggcgc
gttatcaaggggcaaagagcaaccgaagcacagtgcaagaaagttaacgctatcgagcgc
gataaagcgttggcgtgggttgaaaagaatgtgcacgttccgctgacgccaccgcagaag
gtcggcatagcctcattctgcccatacaacatcgggccgggtaagtgcttcccctcgacg
ttctaccgcaagctgaatgccggagaccgcaaaggggcatgcgcggagatccgccgttgg
gtattcgacggcggccgggattgccgactgaccaaaggccaaaagaatggctgttacggg
caggttgaccgccgggagcaggaaagtgctttgacgtgctgggggctgtacgaatga

DBGET integrated database retrieval system