KEGG   Enterobacter aerogenes EA1509E: ST548_p7973Help
Entry
ST548_p7973       CDS       T02447                                 

Definition
GTP cyclohydrolase I type 1 (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
ear  Enterobacter aerogenes EA1509E
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ear00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
275007..275675
Genome map
AA seq 222 aa AA seqDB search
MSSLSKEAILVHEALVARGLETPLRPPVQEIDNETRKRLIAGHMTEIMQLLNLDLSDDSL
METPHRIAKMYVDEIFSGLDYARFPKITVIENKMKVDEMVTVRDITLTSTCEHHFVTIDG
KATVAYIPKDSVIGLSKINRIVQFFAQRPQVQERLTQQILTALQTLLGTSNVAVSIDAVH
YCVKARGIRDATSATTTTSLGGLFKSSQNTRQEFLRAVRHHN
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcattgagtaaagaagccatactcgttcatgaagcgctggtcgctcgtgggctg
gagacgccgctgcgtccgccagtacaagaaattgataatgaaacgcgcaagcgtctgatc
gccgggcacatgactgagattatgcaactgctgaatcttgatctcagtgacgacagcctg
atggaaactccgcatcgcatcgcaaaaatgtacgttgatgagattttctccggtctggat
tacgccagattcccgaaaatcaccgttattgaaaacaaaatgaaagttgacgagatggtg
acggtccgcgatatcacgctgaccagtacctgtgaacatcactttgtgacgattgacggc
aaagcgaccgttgcttatatcccgaaagattcggtaatcggcctgtcgaaaattaaccgc
atcgtgcagttctttgcccagcgtccgcaggtgcaggagcgcctgacgcagcagattctt
accgcgctgcagactttgctcggtaccagcaacgtcgcggtatccattgacgcggtgcat
tactgcgtgaaagcgcgcggcatccgcgatgcgaccagcgccacgaccaccacttcgctt
ggcggtctgtttaaatccagccagaatacccgccaggagttcctgcgcgccgtacgtcac
cacaattaa

DBGET integrated database retrieval system