KEGG   Enterobacter asburiae LF7a: Entas_0177Help
Entry
Entas_0177        CDS       T01604                                 

Definition
Xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
eas  Enterobacter asburiae LF7a
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eas00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Entas_0177
   00051 Fructose and mannose metabolism
    Entas_0177
Enzymes [BR:eas01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     Entas_0177
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
184291..185676
Genome map
AA seq 461 aa AA seqDB search
MSIHYYSSIDYSPHPLIMELNMQAYFDQLDRVRYEGPKTSNHLAFRHYNPDELVLGKRME
DHLRFAACYWHTFCWNGADMFGVGSFDRPWQQPGEAIELAKRKADVAFEFFHKLNVPYYC
FHDVDVSPEGASLKEYLNNFAQMVDVLAAKQQQSGVKLLWGTANCFTNPRYGAGAATNPD
PEVFSWAATQVVTAMNATHQLGGENYVLWGGREGYETLLNTDLRQEREQIGRFMQMVVEH
KHKIGFRGTLLIEPKPQEPTKHQYDYDVATVYGFLKQFGLEKEIKVNIEANHATLAGHSF
HHEIASAIALGIFGSVDANRGDAQLGWDTDQFPNSVEENALVMYEIIKAGGFTTGGLNFD
AKVRRQSTDKYDLFYGHIGAMDTMALALKVAARMIEDGELDKRVAKRYSGWNSELGQQIL
KGQLSLADIAKYAEQHHLAPQHQSGHQELLENLVNHYLFDK
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgtctattcactattactccagtatcgactactcgccgcatcccttgattatggagctc
aatatgcaagcttatttcgaccaactcgatcgcgttcgttacgaaggcccgaaaacgtcc
aatcatttagcatttcgtcattacaacccggatgagctggtgctgggtaagcgcatggaa
gaccatctgcgctttgccgcctgttactggcacaccttctgctggaatggcgccgatatg
ttcggtgtgggttccttcgaccgcccgtggcagcaacccggcgaggccattgagctggcg
aagcgtaaagcggatgttgcgtttgaattcttccacaagctgaacgtgccgtattactgc
ttccacgatgtggatgtgtcaccggaaggcgcatccctgaaagagtatctgaacaacttt
gcacaaatggttgacgtgctggcagcgaaacagcagcaaagtggcgtgaaactgctgtgg
ggcacagcaaactgcttcactaacccgcgttatggtgccggtgcggcaacaaaccctgac
ccagaagtgttcagttgggccgccacccaggtggtgaccgcaatgaacgcaacccatcag
ctgggtggcgagaactacgttctctgggggggccgcgaaggttatgaaaccctgctgaac
accgatttgcgccaggagcgtgaacagattggtcgctttatgcagatggttgtcgagcat
aaacacaaaatcggtttccgcggcacgttgctgattgagccaaaaccgcaagagccaacc
aagcatcagtacgattatgacgttgccaccgtgtacggcttcctgaagcagtttggtctg
gaaaaagagatcaaagtgaatatcgaagccaaccacgccacgctggcgggtcactctttc
catcatgaaatcgcttctgccattgcgctcggtatctttggttctgttgatgcgaaccgt
ggcgatgcacagctgggctgggataccgatcagttcccgaacagcgttgaagaaaatgcg
ctggtgatgtacgaaatcatcaaagcaggtggcttcaccacgggtggcctgaacttcgat
gccaaagtgcgccgtcagagtactgacaaatatgacctgttctacggccacattggcgcg
atggacaccatggcgctggcgctgaaagtcgcggctcgtatgattgaagacggtgagctg
gataagcgcgtagcgaagcgttatagcggctggaacagtgagctgggccagcaaattttg
aaaggccagttatcgcttgccgacatcgcgaagtacgctgaacagcatcatctggcgcca
cagcaccaaagcggacaccaggagttgctggaaaacctggtgaatcactacctgttcgat
aagtaa

DBGET integrated database retrieval system